PRGDB00063644 (CNL-B29)

From PRG Wiki
Jump to: navigation, search
CNL-B29
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342065 (FJ817289)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC 48-B10, complete sequence.

DNA Sequence

ATGGCAGCAGCACTTGTTGGTGGTGCTCTTCTTTCCGCCTTTCTTCAGGTTGCATTCGACAGGCTCGCTTCTCCTCAACTTCTACACTTCTTTCGTAGAAGAAAACTTGATGAGAAGCTCCTCCGCAAATTGAAAATCATGCTGCGCTCCATCAATGCCCTCGCTGATGATGCTGAACTAAAGCAGTTCACAGATCCACTCGTCAAAGAATGGCTTTTCGATGTCAAAGAGGCTGTCTTTGATGCAGAGGATCTGTTGGGTGAAATAGACTATGAACTCACCAGATGCCAAGTCGAAGCTCAATACGAACCTCAAACCTTTACTTCCAAGGTATCAAATTTCGTCGACTCTACTTTCACTTCATTTAACAAGAAAATTGAATCAGATATGAAAGAAGTCCTCGAGACACTAGAATCTCTTGAAAACCAAAAGGATGCTCTTGGTTTGAAAAGGGGTACTTATTCTGATGATAATGATAGATCAGGCAGTAGAGTGTCACAGAAATTGCCATCATCTTCTTTGGTGGCTGAAAGTGTTAATTATGGCAGAGATGCTGACAAAGATATAATCATTAATTGGCTCACATCTGAAACTGACAATCCCAACCAGCCATCAATACTTTCCATTGTGGGCATGGGTGGGTTGGGTAAGACCACCATGGCCCAGCATGTGTTCAGTGATCCTAAGATCAAAGATGCAAAATTTGATATCAAAGCCTGGGTTTGTGTTTCTGATCATTTTCATGTTTTGACCGTGATAAGAACAATTCTTGAGGCAATCACAAATCAAAATGATGACAGTAGGAACCTAGGAATGGTTCACAAAAAACTGAAAGAAAAATTGTTAGGAAAGAAATTTCTTCTTGTTTTGGATGATGTTTGGAACGAAAGACCAGCAGAATGGGAAGCTGTGCGAACTCCTCTTAGCTACGGGGCTCCAGGAAGTAGAATTCTTGTCACAACTCGCAGTGAGAAAGTTGCTTCTAGCATGAGGTCTAAAGTGCATCTTCTAAAGCAATTAGGAGAGGATGAATGCTGGAAAGTTTTTGAAAATCATGCATTAAAAGATGGTGATCTTGAATTGAATGATGAGTTAATGAAGGTTGGTAGAAGAATAGTTGAGAAGTGCAAGGGATTACCTCTAGCTCTGAAAACAATTGGATGTCTTTTGAGCACAAAGTCATCCATTTCAGATTGGAAGAACATATTGGAAAGTGACATATGGGAGTTACCAAAAGAACACAGTGAAATTATTCCTGCGTTATTTTTGAGCTATCGCCATCTTCCTTCTCATCTTAAAAGGTGCTTTGCTTATTGTGCCTTATTTCCCAAAGATTATGAGTTTGTGAAGGAGGAGTTAATTTTTTTGTGGATGGCCCAAAATTTTCTACTGAGTCCACAACATATTAGAGATCCAGAAGAAATTGGTGAAGAGTACTTCAATGATCTACTGTCAAGGTGTTTTTTTAACCAATCAAGCGTCGTAGGGTGTTTCGTCATGCATGACCTTCTGAATGATTTGGCAAAATATGTCTGTGCGGATTTCTGTTTCAGGTTGAAATTTGATAAAGGCCGATGTATACCGAAAACAACCCGTCATTTTTCATTCGAATTCAATGTTGTCAAAAGTTTTGATGGTTTTGGGAGTTTAACTGATGCTAAAAGACTTCGTTCATTTCTTTCTATATCAAAATCTTGGGGAGCTGAATGGCATTTCGAGATTTCGATACATAATTTGTTTTCCAAGATTAAGTTTATACGCGTGTTATCTTTCCGTGGTTGTTTAGACCTTAGAGAGGTCCCAGATTCTGTAGGTGATCTTAAACATCTCCAATCGTTAGATCTTTCGTCCACAGAGATACAAAAGCTACCTGACTCGATATGTTTGCTCTATAAGTTACTAATACTGAAGTTGAGCTCTTGTTCAATGTTGGAGGAGTTTCCCTCAAATTTGCATAAGCTTACCAAATTGCGTTGCCTGGAATTTAAAGGTACAAAAGTGAGAAAGATGCCAATGCATTTTGGAGAATTGAAGAATCTTCAAGTACTAAGTATGTTTTACGTGGATAAAAATAGTGAGCTAAGTACTAAGGAACTGGGCGGATTGGGAGGACTCAATCTTCATGGAAGGCTATCAATCATTGACGTGCAGAATATTGGGAATCCTTTGGATGCATTAAAAGCAAATTTGAAAGATAAACGCCTTGTGGAGCTAAAATTAAATTGGAAGTCGGACCACATCCCTGATGATCCAAAGAAAGAAAAGGAAGTACTTCAGAATCTACAACCTTCCAATCACTTGGAGAAATTGTCAATCAGGAACTACAATGGTACAGAATTCCCAAGTTGGGAATTCGATAATTCGTTATCAAATCTGGTGGTCTTAAAGTTGAAGGACTGTAAATACTGCCTATGTTTGCCTCCCCTTGGACTTTTGTCATCACTGAAGACCCTTAAAATTAGTGGGCTTGATGGAATAGTGAGCATTGGTGCTGAATTTTATGGGAGCAACTCTTCGTTTGCATCCTTGGAGAGGTTGGAATTCATCAGTATGAAGGAATGGGAAGAATGGGAGTGTAAAACTACTTCTTTTCCACGTCTTGAAGAGCTTTATGTGGATAATTGTCCGAAACTGAAAGGTACGAAAGTAGTTGTTAGTGATGAGGTCAGAATTAGCGGAAACAGTATGGACACATCGCATACTGATGGAGGCAGCTTTCGACTACATTTCTTTCCAAAGCTCCATGAACTTGAATTGATAGACTGCCAAAACCTAAGAAGAATTTCACAGGAGTACGCTCATAATCATCTCACGTCTCTATATATTTATGCTTGCGCTCAATTTAAATCATTCCTGTTTCCCAAACCCATGCAAATCCTGTTTCCGTCCCTTACCGGGCTGCATATAATTAAGTGTCCAGAAGTTGAGTTGTTCCCAGATGGAGGTTTGCCATTAAATATAAAAAGAATGTCTCTTTCATGTTTAAAACTTATCGCCTCCTTGAGAGACAACTTGGATCCCAACACATCTCTTCAAACCTTGACTATTCAAAAGTTGGAGGTGGAGTGTTTTCCCGATGAAGTTTTGCTCCCACGCTCTCTCACCTCTCTAGAAATCCAATTTTGCCGAAATCTTAAAAAGATGCACTACAAGGGTCTCTGCCACCTCTCCTCTCTCTCACTTGAGTATTGTCCCAGCCTTGAAAGCTTACCAGCGGAGGGTCTCCCCAAATCCATCTCTTCTCTTACAATCTGTGGTTGTCCATTGCTGAAGGAGCGTTGTCGGAATCCAGATGGCGAAGACTGGGGAAAGATTGCTCACATCCAAAAACTGCAAGTTCAAAATTAG


Protein sequences

Name Description Sequence
CNL-B29 CNL-B29 [Phaseolus vulgaris].

MAAALVGGALLSAFLQVAFDRLASPQLLHFFRRRKLDEKLLRKLKIMLRSINALADDAELKQFTDPLVKEWLFDVKEAVFDAEDLLGEIDYELTRCQVEAQYEPQTFTSKVSNFVDSTFTSFNKKIESDMKEVLETLESLENQKDALGLKRGTYSDDNDRSGSRVSQKLPSSSLVAESVNYGRDADKDIIINWLTSETDNPNQPSILSIVGMGGLGKTTMAQHVFSDPKIKDAKFDIKAWVCVSDHFHVLTVIRTILEAITNQNDDSRNLGMVHKKLKEKLLGKKFLLVLDDVWNERPAEWEAVRTPLSYGAPGSRILVTTRSEKVASSMRSKVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSISDWKNILESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYEFVKEELIFLWMAQNFLLSPQHIRDPEEIGEEYFNDLLSRCFFNQSSVVGCFVMHDLLNDLAKYVCADFCFRLKFDKGRCIPKTTRHFSFEFNVVKSFDGFGSLTDAKRLRSFLSISKSWGAEWHFEISIHNLFSKIKFIRVLSFRGCLDLREVPDSVGDLKHLQSLDLSSTEIQKLPDSICLLYKLLILKLSSCSMLEEFPSNLHKLTKLRCLEFKGTKVRKMPMHFGELKNLQVLSMFYVDKNSELSTKELGGLGGLNLHGRLSIIDVQNIGNPLDALKANLKDKRLVELKLNWKSDHIPDDPKKEKEVLQNLQPSNHLEKLSIRNYNGTEFPSWEFDNSLSNLVVLKLKDCKYCLCLPPLGLLSSLKTLKISGLDGIVSIGAEFYGSNSSFASLERLEFISMKEWEEWECKTTSFPRLEELYVDNCPKLKGTKVVVSDEVRISGNSMDTSHTDGGSFRLHFFPKLHELELIDCQNLRRISQEYAHNHLTSLYIYACAQFKSFLFPKPMQILFPSLTGLHIIKCPEVELFPDGGLPLNIKRMSLSCLKLIASLRDNLDPNTSLQTLTIQKLEVECFPDEVLLPRSLTSLEIQFCRNLKKMHYKGLCHLSSLSLEYCPSLESLPAEGLPKSISSLTICGCPLLKERCRNPDGEDWGKIAHIQKLQVQN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
5-878 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LVGGALLSAFLQVAFDRLASPQLLHFFRRRKLDEKLLRKLKIMLRSINALADDAELKQFTDPLVKEWLFDVKEAVFDAEDLLGEIDYELTRCQVEAQYEPQTFTSKVSNFVDSTFTSFNKKIESDMKEVLETLESLENQKDALGLKRGTYSDDNDRSGSRVSQKLPSSSLVAESVNYGRDADKDIIINWLTSETDNPNQPSILSIVGMGGLGKTTMAQHVFSDPKIKDAKFDIKAWVCVSDHFHVLTVIRTILEAITNQNDDSRNLGMVHKKLKEKLLGKKFLLVLDDVWNERPAEWEAVRTPLSYGAPGSRILVTTRSEKVASSMRSKVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSISDWKNILESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYEFVKEELIFLWMAQNFLLSPQHIRDPEEIGEEYFNDLLSRCFFNQSSVVGCFVMHDLLNDLAKYVCADFCFRLKFDKGRCIPKTTRHFSFEFNVVKSFDGFGSLTDAKRLRSFLSISKSWGAEWHFEISIHNLFSKIKFIRVLSFRGCLDLREVPDSVGDLKHLQSLDLSSTEIQKLPDSICLLYKLLILKLSSCSMLEEFPSNLHKLTKLRCLEFKGTKVRKMPMHFGELKNLQVLSMFYVDKNSELSTKELGGLGGLNLHGRLSIIDVQNIGNPLDALKANLKDKRLVELKLNWKSDHIPDDPKKEKEVLQNLQPSNHLEKLSIRNYNGTEFPSWEFDNSLSNLVVLKLKDCKYCLCLPPLGLLSSLKTLKISGLDGIVSIGAEFYGSNSSFASLERLEFISMKEWEEWECKTTSFPRLEELYVDNCPKL

HMMPanther: PTHR23155
5-878 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVGGALLSAFLQVAFDRLASPQLLHFFRRRKLDEKLLRKLKIMLRSINALADDAELKQFTDPLVKEWLFDVKEAVFDAEDLLGEIDYELTRCQVEAQYEPQTFTSKVSNFVDSTFTSFNKKIESDMKEVLETLESLENQKDALGLKRGTYSDDNDRSGSRVSQKLPSSSLVAESVNYGRDADKDIIINWLTSETDNPNQPSILSIVGMGGLGKTTMAQHVFSDPKIKDAKFDIKAWVCVSDHFHVLTVIRTILEAITNQNDDSRNLGMVHKKLKEKLLGKKFLLVLDDVWNERPAEWEAVRTPLSYGAPGSRILVTTRSEKVASSMRSKVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSISDWKNILESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYEFVKEELIFLWMAQNFLLSPQHIRDPEEIGEEYFNDLLSRCFFNQSSVVGCFVMHDLLNDLAKYVCADFCFRLKFDKGRCIPKTTRHFSFEFNVVKSFDGFGSLTDAKRLRSFLSISKSWGAEWHFEISIHNLFSKIKFIRVLSFRGCLDLREVPDSVGDLKHLQSLDLSSTEIQKLPDSICLLYKLLILKLSSCSMLEEFPSNLHKLTKLRCLEFKGTKVRKMPMHFGELKNLQVLSMFYVDKNSELSTKELGGLGGLNLHGRLSIIDVQNIGNPLDALKANLKDKRLVELKLNWKSDHIPDDPKKEKEVLQNLQPSNHLEKLSIRNYNGTEFPSWEFDNSLSNLVVLKLKDCKYCLCLPPLGLLSSLKTLKISGLDGIVSIGAEFYGSNSSFASLERLEFISMKEWEEWECKTTSFPRLEELYVDNCPKL

superfamily: SSF52540
163-414 SSF52540

SRVSQKLPSSSLVAESVNYGRDADKDIIINWLTSETDNPNQPSILSIVGMGGLGKTTMAQHVFSDPKIKDAKFDIKAWVCVSDHFHVLTVIRTILEAITNQNDDSRNLGMVHKKLKEKLLGKKFLLVLDDVWNERPAEWEAVRTPLSYGAPGSRILVTTRSEKVASSMRSKVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSISDWKNILESDIWELPKEH

Gene3D: G3DSA:3.40.50.300
182-330 G3DSA:3.40.50.300

GRDADKDIIINWLTSETDNPNQPSILSIVGMGGLGKTTMAQHVFSDPKIKDAKFDIKAWVCVSDHFHVLTVIRTILEAITNQNDDSRNLGMVHKKLKEKLLGKKFLLVLDDVWNERPAEWEAVRTPLSYGAPGSRILVTTRSEKVASSM

HMMPfam: PF00931
IPR002182
184-463 NB-ARC,NBS
NB-ARC

DADKDIIINWLTSETDNPNQPSILSIVGMGGLGKTTMAQHVFSDPKIKDAKFDIKAWVCVSDHFHVLTVIRTILEAITNQNDDSRNLGMVHKKLKEKLLGKKFLLVLDDVWNERPAEWEAVRTPLSYGAPGSRILVTTRSEKVASSMRSKVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSISDWKNILESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYEFVKEELIFLWMAQNFL

FPrintScan: PR00364
IPR000767
206-221 DISEASERSIST
Disease resistance protein

ILSIVGMGGLGKTTMA

FPrintScan: PR00364
IPR000767
280-294 DISEASERSIST
Disease resistance protein

KLLGKKFLLVLDDVW

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

CKGLPLALKTIGCLL

superfamily: SSF52058
499-882 SSF52058,LRR

VMHDLLNDLAKYVCADFCFRLKFDKGRCIPKTTRHFSFEFNVVKSFDGFGSLTDAKRLRSFLSISKSWGAEWHFEISIHNLFSKIKFIRVLSFRGCLDLREVPDSVGDLKHLQSLDLSSTEIQKLPDSICLLYKLLILKLSSCSMLEEFPSNLHKLTKLRCLEFKGTKVRKMPMHFGELKNLQVLSMFYVDKNSELSTKELGGLGGLNLHGRLSIIDVQNIGNPLDALKANLKDKRLVELKLNWKSDHIPDDPKKEKEVLQNLQPSNHLEKLSIRNYNGTEFPSWEFDNSLSNLVVLKLKDCKYCLCLPPLGLLSSLKTLKISGLDGIVSIGAEFYGSNSSFASLERLEFISMKEWEEWECKTTSFPRLEELYVDNCPKLKGTK

Gene3D: G3DSA:3.80.10.10
554-766 G3DSA:3.80.10.10

KRLRSFLSISKSWGAEWHFEISIHNLFSKIKFIRVLSFRGCLDLREVPDSVGDLKHLQSLDLSSTEIQKLPDSICLLYKLLILKLSSCSMLEEFPSNLHKLTKLRCLEFKGTKVRKMPMHFGELKNLQVLSMFYVDKNSELSTKELGGLGGLNLHGRLSIIDVQNIGNPLDALKANLKDKRLVELKLNWKSDHIPDDPKKEKEVLQNLQPSNH

FPrintScan: PR00364
IPR000767
605-621 DISEASERSIST
Disease resistance protein

GDLKHLQSLDLSSTEIQ

ProfileScan: PS51450
IPR001611
609-630 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQSLDLSSTEIQKLPDSICLL

Gene3D: G3DSA:3.80.10.10
767-917 G3DSA:3.80.10.10

LEKLSIRNYNGTEFPSWEFDNSLSNLVVLKLKDCKYCLCLPPLGLLSSLKTLKISGLDGIVSIGAEFYGSNSSFASLERLEFISMKEWEEWECKTTSFPRLEELYVDNCPKLKGTKVVVSDEVRISGNSMDTSHTDGGSFRLHFFPKLHEL

superfamily: SSF52058
888-1107 SSF52058,LRR

EVRISGNSMDTSHTDGGSFRLHFFPKLHELELIDCQNLRRISQEYAHNHLTSLYIYACAQFKSFLFPKPMQILFPSLTGLHIIKCPEVELFPDGGLPLNIKRMSLSCLKLIASLRDNLDPNTSLQTLTIQKLEVECFPDEVLLPRSLTSLEIQFCRNLKKMHYKGLCHLSSLSLEYCPSLESLPAEGLPKSISSLTICGCPLLKERCRNPDGEDWGKIAH

Gene3D: G3DSA:3.80.10.10
918-1087 G3DSA:3.80.10.10

ELIDCQNLRRISQEYAHNHLTSLYIYACAQFKSFLFPKPMQILFPSLTGLHIIKCPEVELFPDGGLPLNIKRMSLSCLKLIASLRDNLDPNTSLQTLTIQKLEVECFPDEVLLPRSLTSLEIQFCRNLKKMHYKGLCHLSSLSLEYCPSLESLPAEGLPKSISSLTICGC


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox