PRGDB00063645 (CNL-B28)

From PRG Wiki
Jump to: navigation, search
CNL-B28
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342065 (FJ817289)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC 48-B10, complete sequence.

DNA Sequence

ATGGAAGTTGTTGTTGGTGGCGCTCTTCTTTCCGCCTTTCTTAAGGTTGCATTCGAGAGGCTTGCTTCTCCTCAATTTCTACACTTCTTTCGTGGAAGAAAACTTGATGAGAAGCTCCTCGCCAATTTGAACATCAAGCTGCATTCCATCGATGCTCTCGCTGATGATGCTGAACTAAAGCAGTTCACAGATCCACACGTCAAAGCATGGCTTTTTGCTGTCAAAGAGGCTGTCTTTGATGCAGAGGATCTTTTGGGTGAAATAGACTATGAACTCACCAGACGCCAAGTCAAAGCTCAATTCAAACCTCAAACCTTTACTTGCAAGGTACCAAATATATTCAACTCTATTTTCAATTCATTTAACAAGAAAATTGAATTTGGGATGAACGAAGTACTTGAGAAACTAGAATATCTTGCAAACCAAAAGGGTGATCTTGGTTTGAAGGAGGGTACTTATTCTGGTGATGGATCAGGTAGTAACGTGCCAAAGAAATTGCCATCATCTTCTTTGGTGGCTGAAAGTGTTATTTATGGTAGAGATGCTGACAAAGATATAATCATTAATTGGCTCACATCTGAAATTGACAATCCTAACCACCCATCAATACTTTCCATTGTGGGCATGGGTGGCTTGGGTAAGACCACACTCGCCCAACATGTGTACAGTGACCCAAAGATCGAGGATTTAAAATTTGATATCAAAGCATGGGTCTGTGTTTCTGATCATTTTCATGTTTTGACCGTGACAAGAACAATTCTTGAGGCAATCACAAATCAAAAAGATGATAGTGGGAACCTAGAAATGGTTCACAAAAAACTGAAAGAAAAATTGTCAGGAAAGAAATTTCTTCTTGTTTTGGATGATGTTTGGAACGAAAGACCAGCAGAATGGGAAGCTGTGCGAACTCCTCTTAGCTGTGGGGCTCCAGGAAGTAGAATTCTTGTCACAGCTCGCAGTGAGAAAGTTGCTTCTAGCATGAGGTCTGAAGTGCATCTTCTAAAGCAATTAGGAGAGGATGAATGCTGGAAAGTTTTTGAAAATCATGCATTAAAAGATGGTGATCTTGAATTGAATGATGAGTTAATGAAGGTTGGTAGAAGAATAGTTGAGAAGTGCAAGGGATTACCTCTAGCTCTCAAAACAATTGGATGTCTTTTGAGCACAAAGTCATCCGTTTCAGATTGGAAGAACATAATGGAAAGTGACATATGGGAGTTACCCAAAGAACACAGTGAAATTATTCCTGCGTTATTTTTGAGCTATCGCCATCTTCCTTCTCATCTTAAACGATGCTTTGCTTATTGTGCCTTATTCCCCAAAGATTATAGGTTTGAGAAGGAGGAGTTAATTTTGTTGTGGATGGCACACAATTTTCTACAGAGTCCACAACATATTAGACATCCAGAAGAAGTTGGTGAAGAGTACTTCAATGATCTACTGTCAAGGTCTTTTTTTCAACATTCACATGGCGAGAGATGTTTCGTCATGCATGACCTTCTGAATGATTTGGCAAAATATGTATGTGCGGATTTCTGTTTCAGGTTGAAATTTGATAAAGGCGAATGTATACATAAAACAACCCGTCACTTTTCATTTGAATTTCGTGACGTCAAAAGTTTTGATGGTTTTGAGAGTTTAACTGATGCTAAAAGACTTCATTCATTTCTTCCTATCTCAAATTCTTGGAGGGCTGAATGGCATTTCAAGATTTCGATACATAATTTGTTTTCCAAAATTAAGTTTATACGCATGTTATCTTTCCGTGGTTGTGTAGACCTTAGAGAGGTCCCAGATTCTGTAGGTGATCTTAAACATCTCCAATCGTTAGATATTTCGTGTACTGGGATACAAAAGCTACCTGACTCGATATGTTTGCTCTATAACTTACTAATACTGAAGTTGAACAATTGTTCAATGTTGAAGGAGTTTCCCTTAAATTTGCATAGGCTTACCAAATTGCGTTGCCTGGAATTTGAAGGTACAAAAGTGAGAAAGATGCCAATGCATTTTGGAGAATTGAAGAATCTTCAAGTACTTAGTATGTTTTTGGTGGATAAAAATAGTGAGCTAAGTACTAAGCAACTGGGCGGATTGGGAGGACTCAATCTTCATGGAAGGCTATCAATCAATGACGTGCAGAATATTGGGAATCCTTTGGATGCATTAAAAGCAAATTTGAAAGATAAACGCCTTGTGAAGCTAGAATTAAAATGGAAGTCGGACCACATGCCTGATGATCCAAAGAAAGAAAAGGAAGTACTTCAGAATCTACAACCTTCCAATCACTTGGAGAATTTGTCTATTAGGAACTACAATGGTACAGAATTCCCAAGTTGGGAATTCGATAATTCGTTATCAAATCTGGTGTTCTTAGAGTTGAGGAACTGTAAATACTGCCTATGTTTGCCTCCCCTTGGACTTTTGTCATCACTGAAGACCCTCGAGATTATAGGGTTAGATGGAATAGTGAGCGTTGGTGATGAATTTTATGGGAGTAACTCTTCGTTTGCATCCTTGGAGAGGTTGGAATTCTGGAATATGAAGGAATGGGAAGAATGGGAGTGTAAAACTACTTCTTTTCCACGTCTTCAAGAGCTTTATGTGGATAGATGTCCGAAACTGAAAGGTACGAAAGTAGTTGTTAGTGATGAGCTCAGAATTAGCGGAAACAGTATGGACACATCGCATACTGATTGCCCTCAATTTAAATCATTCCTGTTTCCGTCCCTTACTACGTTGGACATAACTAATTGTCCAGAAGTGGAGTTGTTCCCAGATGGAGGTTTGCCATTAAATATAAAACATATCTCTCTTTCATGTTTTAAACTTATCGCCTCCTTGAGAGACAACTTGGATCCCAACACATCTCTTCAACACTTGATTATTCACAATTTGGAGGTGGAGTGTTTTCCCGATGAAGTTTTGCTGCCACGCTCTCTCACCTATCTATATATCTATGATTGCCCAAATCTTAAAAAGATGCACTACAAGGGTCTCTGCCACCTCTCCTCTCTCTCACTTCATACTTGTCCCAGCCTTGAATCCTTACCAGCGGAGGGTCTCCCCAAATCCATCTCTTCTCTTACAATATGGGATTGTCCATTGCTGAAGGAGCGTTGTCGGAATCCAGATGGCGAAGACTGGGGAAAGATTGCTCACATCCAAGAACTGCATGTGCGATGA


Protein sequences

Name Description Sequence
CNL-B28 CNL-B28 [Phaseolus vulgaris].

MEVVVGGALLSAFLKVAFERLASPQFLHFFRGRKLDEKLLANLNIKLHSIDALADDAELKQFTDPHVKAWLFAVKEAVFDAEDLLGEIDYELTRRQVKAQFKPQTFTCKVPNIFNSIFNSFNKKIEFGMNEVLEKLEYLANQKGDLGLKEGTYSGDGSGSNVPKKLPSSSLVAESVIYGRDADKDIIINWLTSEIDNPNHPSILSIVGMGGLGKTTLAQHVYSDPKIEDLKFDIKAWVCVSDHFHVLTVTRTILEAITNQKDDSGNLEMVHKKLKEKLSGKKFLLVLDDVWNERPAEWEAVRTPLSCGAPGSRILVTARSEKVASSMRSEVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSVSDWKNIMESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYRFEKEELILLWMAHNFLQSPQHIRHPEEVGEEYFNDLLSRSFFQHSHGERCFVMHDLLNDLAKYVCADFCFRLKFDKGECIHKTTRHFSFEFRDVKSFDGFESLTDAKRLHSFLPISNSWRAEWHFKISIHNLFSKIKFIRMLSFRGCVDLREVPDSVGDLKHLQSLDISCTGIQKLPDSICLLYNLLILKLNNCSMLKEFPLNLHRLTKLRCLEFEGTKVRKMPMHFGELKNLQVLSMFLVDKNSELSTKQLGGLGGLNLHGRLSINDVQNIGNPLDALKANLKDKRLVKLELKWKSDHMPDDPKKEKEVLQNLQPSNHLENLSIRNYNGTEFPSWEFDNSLSNLVFLELRNCKYCLCLPPLGLLSSLKTLEIIGLDGIVSVGDEFYGSNSSFASLERLEFWNMKEWEEWECKTTSFPRLQELYVDRCPKLKGTKVVVSDELRISGNSMDTSHTDCPQFKSFLFPSLTTLDITNCPEVELFPDGGLPLNIKHISLSCFKLIASLRDNLDPNTSLQHLIIHNLEVECFPDEVLLPRSLTYLYIYDCPNLKKMHYKGLCHLSSLSLHTCPSLESLPAEGLPKSISSLTIWDCPLLKERCRNPDGEDWGKIAHIQELHVR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
4-875 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

VVGGALLSAFLKVAFERLASPQFLHFFRGRKLDEKLLANLNIKLHSIDALADDAELKQFTDPHVKAWLFAVKEAVFDAEDLLGEIDYELTRRQVKAQFKPQTFTCKVPNIFNSIFNSFNKKIEFGMNEVLEKLEYLANQKGDLGLKEGTYSGDGSGSNVPKKLPSSSLVAESVIYGRDADKDIIINWLTSEIDNPNHPSILSIVGMGGLGKTTLAQHVYSDPKIEDLKFDIKAWVCVSDHFHVLTVTRTILEAITNQKDDSGNLEMVHKKLKEKLSGKKFLLVLDDVWNERPAEWEAVRTPLSCGAPGSRILVTARSEKVASSMRSEVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSVSDWKNIMESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYRFEKEELILLWMAHNFLQSPQHIRHPEEVGEEYFNDLLSRSFFQHSHGERCFVMHDLLNDLAKYVCADFCFRLKFDKGECIHKTTRHFSFEFRDVKSFDGFESLTDAKRLHSFLPISNSWRAEWHFKISIHNLFSKIKFIRMLSFRGCVDLREVPDSVGDLKHLQSLDISCTGIQKLPDSICLLYNLLILKLNNCSMLKEFPLNLHRLTKLRCLEFEGTKVRKMPMHFGELKNLQVLSMFLVDKNSELSTKQLGGLGGLNLHGRLSINDVQNIGNPLDALKANLKDKRLVKLELKWKSDHMPDDPKKEKEVLQNLQPSNHLENLSIRNYNGTEFPSWEFDNSLSNLVFLELRNCKYCLCLPPLGLLSSLKTLEIIGLDGIVSVGDEFYGSNSSFASLERLEFWNMKEWEEWECKTTSFPRLQELYVDRCPKL

HMMPanther: PTHR23155
4-875 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VVGGALLSAFLKVAFERLASPQFLHFFRGRKLDEKLLANLNIKLHSIDALADDAELKQFTDPHVKAWLFAVKEAVFDAEDLLGEIDYELTRRQVKAQFKPQTFTCKVPNIFNSIFNSFNKKIEFGMNEVLEKLEYLANQKGDLGLKEGTYSGDGSGSNVPKKLPSSSLVAESVIYGRDADKDIIINWLTSEIDNPNHPSILSIVGMGGLGKTTLAQHVYSDPKIEDLKFDIKAWVCVSDHFHVLTVTRTILEAITNQKDDSGNLEMVHKKLKEKLSGKKFLLVLDDVWNERPAEWEAVRTPLSCGAPGSRILVTARSEKVASSMRSEVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSVSDWKNIMESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYRFEKEELILLWMAHNFLQSPQHIRHPEEVGEEYFNDLLSRSFFQHSHGERCFVMHDLLNDLAKYVCADFCFRLKFDKGECIHKTTRHFSFEFRDVKSFDGFESLTDAKRLHSFLPISNSWRAEWHFKISIHNLFSKIKFIRMLSFRGCVDLREVPDSVGDLKHLQSLDISCTGIQKLPDSICLLYNLLILKLNNCSMLKEFPLNLHRLTKLRCLEFEGTKVRKMPMHFGELKNLQVLSMFLVDKNSELSTKQLGGLGGLNLHGRLSINDVQNIGNPLDALKANLKDKRLVKLELKWKSDHMPDDPKKEKEVLQNLQPSNHLENLSIRNYNGTEFPSWEFDNSLSNLVFLELRNCKYCLCLPPLGLLSSLKTLEIIGLDGIVSVGDEFYGSNSSFASLERLEFWNMKEWEEWECKTTSFPRLQELYVDRCPKL

superfamily: SSF52540
160-411 SSF52540

SNVPKKLPSSSLVAESVIYGRDADKDIIINWLTSEIDNPNHPSILSIVGMGGLGKTTLAQHVYSDPKIEDLKFDIKAWVCVSDHFHVLTVTRTILEAITNQKDDSGNLEMVHKKLKEKLSGKKFLLVLDDVWNERPAEWEAVRTPLSCGAPGSRILVTARSEKVASSMRSEVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSVSDWKNIMESDIWELPKEH

Gene3D: G3DSA:3.40.50.300
179-306 G3DSA:3.40.50.300

GRDADKDIIINWLTSEIDNPNHPSILSIVGMGGLGKTTLAQHVYSDPKIEDLKFDIKAWVCVSDHFHVLTVTRTILEAITNQKDDSGNLEMVHKKLKEKLSGKKFLLVLDDVWNERPAEWEAVRTPLS

HMMPfam: PF00931
IPR002182
181-462 NB-ARC,NBS
NB-ARC

DADKDIIINWLTSEIDNPNHPSILSIVGMGGLGKTTLAQHVYSDPKIEDLKFDIKAWVCVSDHFHVLTVTRTILEAITNQKDDSGNLEMVHKKLKEKLSGKKFLLVLDDVWNERPAEWEAVRTPLSCGAPGSRILVTARSEKVASSMRSEVHLLKQLGEDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLSTKSSVSDWKNIMESDIWELPKEHSEIIPALFLSYRHLPSHLKRCFAYCALFPKDYRFEKEELILLWMAHNFLQS

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

ILSIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
277-291 DISEASERSIST
Disease resistance protein

KLSGKKFLLVLDDVW

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

CKGLPLALKTIGCLL

superfamily: SSF52058
496-879 SSF52058,LRR

VMHDLLNDLAKYVCADFCFRLKFDKGECIHKTTRHFSFEFRDVKSFDGFESLTDAKRLHSFLPISNSWRAEWHFKISIHNLFSKIKFIRMLSFRGCVDLREVPDSVGDLKHLQSLDISCTGIQKLPDSICLLYNLLILKLNNCSMLKEFPLNLHRLTKLRCLEFEGTKVRKMPMHFGELKNLQVLSMFLVDKNSELSTKQLGGLGGLNLHGRLSINDVQNIGNPLDALKANLKDKRLVKLELKWKSDHMPDDPKKEKEVLQNLQPSNHLENLSIRNYNGTEFPSWEFDNSLSNLVFLELRNCKYCLCLPPLGLLSSLKTLEIIGLDGIVSVGDEFYGSNSSFASLERLEFWNMKEWEEWECKTTSFPRLQELYVDRCPKLKGTK

Gene3D: G3DSA:3.80.10.10
573-688 G3DSA:3.80.10.10

IHNLFSKIKFIRMLSFRGCVDLREVPDSVGDLKHLQSLDISCTGIQKLPDSICLLYNLLILKLNNCSMLKEFPLNLHRLTKLRCLEFEGTKVRKMPMHFGELKNLQVLSMFLVDKN

Gene3D: G3DSA:3.80.10.10
752-889 G3DSA:3.80.10.10

KEVLQNLQPSNHLENLSIRNYNGTEFPSWEFDNSLSNLVFLELRNCKYCLCLPPLGLLSSLKTLEIIGLDGIVSVGDEFYGSNSSFASLERLEFWNMKEWEEWECKTTSFPRLQELYVDRCPKLKGTKVVVSDELRIS

FPrintScan: PR00364
IPR000767
784-800 DISEASERSIST
Disease resistance protein

NSLSNLVFLELRNCKYC

superfamily: SSF52058
885-1054 SSF52058,LRR

ELRISGNSMDTSHTDCPQFKSFLFPSLTTLDITNCPEVELFPDGGLPLNIKHISLSCFKLIASLRDNLDPNTSLQHLIIHNLEVECFPDEVLLPRSLTYLYIYDCPNLKKMHYKGLCHLSSLSLHTCPSLESLPAEGLPKSISSLTIWDCPLLKERCRNPDGEDWGKIAH

Gene3D: G3DSA:3.80.10.10
890-1034 G3DSA:3.80.10.10

GNSMDTSHTDCPQFKSFLFPSLTTLDITNCPEVELFPDGGLPLNIKHISLSCFKLIASLRDNLDPNTSLQHLIIHNLEVECFPDEVLLPRSLTYLYIYDCPNLKKMHYKGLCHLSSLSLHTCPSLESLPAEGLPKSISSLTIWDC


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox