PRGDB00063646 (CNL-B27)

From PRG Wiki
Jump to: navigation, search
CNL-B27
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342065 (FJ817289)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC 48-B10, complete sequence.

DNA Sequence

ATGGCAGCAGAAGTTGTTGGTGGTGCTCTTCTTTCCGCCTTTCTTCAGGTTGCATTCGACAGGCTCGCTTCTCCTCAATTTCTACACTTCTTTCGTAGAAGAAAACTTGATGAGAAGCTCCTCGGTAATTTGAACATCATGCTGCACTCCATCAACACTCTAGCAGATGATGCTGAACTAAAGCAGTTCACAGATCCACACGTCAAAGCATGGCTTTTTGCTGTCAAAGAGGCTGTCTTTGATGCAGAGGATCTTTTGGGTGAAATAGACTATGAACTCACCAGATGCCAAGTCCAAGCTCAATCCCAACCTCAAACCTTTACTTACAAGGTATCAAATCTCTTCAACTCTACTTTCACTTCATTTAACAAGAAAATTGAATCAGAGATGAAAGAAGTCCTGGAGAAACTAGAATATCTTACACACCAAAAGGGTGATCTTGGTTTGAAGGAGGGTACTTATTCTGGTGATGGATCAGCTAGTAAAGTGCCATCATCTTCTTTGGTAGTTGAAAGTGTTATTTATGGCAGAGATGCTGACATAGATATAATCATTAATTGGCTCACATCTGAAACCAATAATCCTAACCAACCATCAATACTATCCATTGTGGGCATGGGTGGGTTGGGTAAGACCACACTCGTCCAGCATGTGTACAGTGACCCAAAGATTGAAGATGCAAAATTTGATATCAAAGCATGGGTCTGTGTTTCTGATCATTTTCATGTTTTGACGGTGACAAGAACAATTCTTGAGGCAATCACAAATAAAAAAGATGACAGTGGGAACCTAGAAATGGTTCACAAAAAACTGAAAGAAAAATTGTTAGGAAAGAAATTTCTTCTTGTTTTAGATGATGTTTGGAACGAAAGAGCAGTACAATGGGAAGCTGTGCAAACTCCTCTTAGCTATGGGGCTCCAGGAAGTAGAATTCTTGTCACAACTCGTGGTGAGAAAGTTGCTTCTAGCATGAGGTCTGAAGTGCATCTTCTAAAGCAATTACGAAAGGATGAATGCTGGAAAGTTTTTGAAAATCATGCATTAAAAGATGGTGATCTTGAATTGAATGATGAGTTAATGAAGGTTGGTAGAAGAATAGTTGAGAAGTGCAAGGGATTACCTCTAGCTCTGAAAACAATTGGGTGTCTTTTACGCACAAAGTCATCCATTTCAGATTGGAAGAACATATTGGAAAGTGACATATGGGAGTTACCAAAAGAACACTGTGAAATTATTCCTGCGTTGTTTTTGAGCTATCGCTATCTTCCTTCTCATCTTAAAAGGTGCTTTGCTTATTGTGCCTTATTCCCCAAAGATTATGAGTTTGTGAAGAAGGAGTTAATTTTGATGTGGATGGCCCAAAATTTTCTACAGAGTCCACAACAGATGATAGATCTAGAAGAAGTTGGTGAAGAGTACTTCAATGATCTACTGTCAAGGTCTTTTTTTCAACAATCAAACCTCGTAGGATGTTTCGTCATGCATGACCTTCTGAATGATTTGGCAAAATATGTATGTGCGGATTTTTGTTTCAGGTTGAAATTTGATAAAGGTCGACGTATACCGAAAACAGCCCGTCATTTTTCATTTAAATTCAGTGACATCAAAAGTTTTGATGGTTTTGGGAGTTTGACTGATGCTAAAAGACTTCGTTCATTTCTTCCTATTTCACAATGTTGGGATTCTCAATGGAATTTCAAGATTTCCATACATGATTTGTTTTCCAAGATTAAGTTTATACGCATGTTATCTCTTCGTTGTTCATTCCTTAGAGAGGTCCCGGATTCTGTCGGTGATCTTAAACATCTCCATTCGTTAGATCTTTCCTCTACAGCGATACAAAAGCTACCTGACTCAATATGTTTGCTTTATAACTTACTAATACTGAAGTTGAACCAATGTTTCATGTTGGAGGAATTGCCCATAAATTTGCATAAACTTACCAAATTGCGTTGCCTGGAATTTGAAGGTACAAGAGTGTCAAAGATGCCAATGCATTTTGGAGAATTGAAAAATCTTCAAGTACTGAATCCGTTTTTTGTGGATAGAAATAGTGAGCTAAGTACTAAACAGCTTGGAGGACTCAATCAACATGGAAGGCTATCAATCAATGACGTGCAGAATATTTTGAATCCTTTGGATGCATTAGAAGCAAATGTGAAAGATAAACATCTTGTGAAGCTAGAATTAAAATGGAAGTCAGACCACATTCCTGATGATCCAAGGAAAGAAAAGGAAGTAATTCAGAATCTACAACCCTCCAAACACTTGGAGGATTTAAAAATCTGGAACTACAATGGTACAGAATTCCCAAGTTGGGTATTCGATAATTCGTTATCAAATCTGGTGTTCTTAAAGTTGAACGACTGTAAATACTGCCTATGTTTGCCTCCCCTTGGACTTTTGTCATCACTGAAGACCCTCGAGATTACAGGGTTTGATGGAATAGTGAGCGTTGGTGCTGAATTTTATGGGAGCAACTCTTCATTTGCATCCTTGGAGTGGTTGGAATTCTCCAATATGAAGGAATGGGAAGAATGGGAGTGTGAAACTACTTCTTTTCCACGTCTTCAAGAGCTTTATGTGGGTAATTGTCCCAAACTGAAAGGTACTCATTTGAAGAAAGTAGTTGTTAGTGATGAGCTCAGAATTAGCGGAAACAGTATGGACACATCGCATACTGATGGAGGCAGCGACTCTCTTACAATCTTTCGACTACATTTCTTTCCAAAGCTCCGTTCTCTTCAACTGATAGACTGCCAAAACCTAAGAAGAGTTTCACAGGAGTACGCTCATAATCATCTCATGAATCTAAGTATTGATGATTGCCCTCAATTTAAATCATTCTTGTTTCCCAAACCCATGCAAATCATGTTTCCGTCCCTTACCTTGCTGCATATAACTATGTGTCCAGAAGTTGAGTTGTTCCCAGATGGAGGTTTGCCATTAAATGTAAGATATATGACTCTTTCATGTTTAAAACTTATCGCCTCCTTGAGAGAGAACTTGGATCCCAACACATGTCTTCAAAGCTTGACTATTCAACAGTTGGAGGTGGAGTGTTTTCCCGATGAAGTTTTGCTGCCACGCTCTCTCATCTCTCTATCTATCTATAGTTGTTCAAATCTTAAAAAGATGCACTACAAGGGTCTCTGCCACCTCTCCTCTCTCTCACTTCTTTTTTGTCCCAGCCTTGAATGCTTACCAGCGGAGGGTCTCCCCAAATCCATCTCTTCTCTTGAAATCTTTAATTGTCCATTGCTGAAGGAGCGTTGTCAGAGTCCAGATGGAGAAGATTGGGAAAAGATTGCTCACATAAAAAAACTGCATGTTTGGCCATAA


Protein sequences

Name Description Sequence
CNL-B27 CNL-B27 [Phaseolus vulgaris].

MAAEVVGGALLSAFLQVAFDRLASPQFLHFFRRRKLDEKLLGNLNIMLHSINTLADDAELKQFTDPHVKAWLFAVKEAVFDAEDLLGEIDYELTRCQVQAQSQPQTFTYKVSNLFNSTFTSFNKKIESEMKEVLEKLEYLTHQKGDLGLKEGTYSGDGSASKVPSSSLVVESVIYGRDADIDIIINWLTSETNNPNQPSILSIVGMGGLGKTTLVQHVYSDPKIEDAKFDIKAWVCVSDHFHVLTVTRTILEAITNKKDDSGNLEMVHKKLKEKLLGKKFLLVLDDVWNERAVQWEAVQTPLSYGAPGSRILVTTRGEKVASSMRSEVHLLKQLRKDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLRTKSSISDWKNILESDIWELPKEHCEIIPALFLSYRYLPSHLKRCFAYCALFPKDYEFVKKELILMWMAQNFLQSPQQMIDLEEVGEEYFNDLLSRSFFQQSNLVGCFVMHDLLNDLAKYVCADFCFRLKFDKGRRIPKTARHFSFKFSDIKSFDGFGSLTDAKRLRSFLPISQCWDSQWNFKISIHDLFSKIKFIRMLSLRCSFLREVPDSVGDLKHLHSLDLSSTAIQKLPDSICLLYNLLILKLNQCFMLEELPINLHKLTKLRCLEFEGTRVSKMPMHFGELKNLQVLNPFFVDRNSELSTKQLGGLNQHGRLSINDVQNILNPLDALEANVKDKHLVKLELKWKSDHIPDDPRKEKEVIQNLQPSKHLEDLKIWNYNGTEFPSWVFDNSLSNLVFLKLNDCKYCLCLPPLGLLSSLKTLEITGFDGIVSVGAEFYGSNSSFASLEWLEFSNMKEWEEWECETTSFPRLQELYVGNCPKLKGTHLKKVVVSDELRISGNSMDTSHTDGGSDSLTIFRLHFFPKLRSLQLIDCQNLRRVSQEYAHNHLMNLSIDDCPQFKSFLFPKPMQIMFPSLTLLHITMCPEVELFPDGGLPLNVRYMTLSCLKLIASLRENLDPNTCLQSLTIQQLEVECFPDEVLLPRSLISLSIYSCSNLKKMHYKGLCHLSSLSLLFCPSLECLPAEGLPKSISSLEIFNCPLLKERCQSPDGEDWEKIAHIKKLHVWP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
44-929 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LNIMLHSINTLADDAELKQFTDPHVKAWLFAVKEAVFDAEDLLGEIDYELTRCQVQAQSQPQTFTYKVSNLFNSTFTSFNKKIESEMKEVLEKLEYLTHQKGDLGLKEGTYSGDGSASKVPSSSLVVESVIYGRDADIDIIINWLTSETNNPNQPSILSIVGMGGLGKTTLVQHVYSDPKIEDAKFDIKAWVCVSDHFHVLTVTRTILEAITNKKDDSGNLEMVHKKLKEKLLGKKFLLVLDDVWNERAVQWEAVQTPLSYGAPGSRILVTTRGEKVASSMRSEVHLLKQLRKDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLRTKSSISDWKNILESDIWELPKEHCEIIPALFLSYRYLPSHLKRCFAYCALFPKDYEFVKKELILMWMAQNFLQSPQQMIDLEEVGEEYFNDLLSRSFFQQSNLVGCFVMHDLLNDLAKYVCADFCFRLKFDKGRRIPKTARHFSFKFSDIKSFDGFGSLTDAKRLRSFLPISQCWDSQWNFKISIHDLFSKIKFIRMLSLRCSFLREVPDSVGDLKHLHSLDLSSTAIQKLPDSICLLYNLLILKLNQCFMLEELPINLHKLTKLRCLEFEGTRVSKMPMHFGELKNLQVLNPFFVDRNSELSTKQLGGLNQHGRLSINDVQNILNPLDALEANVKDKHLVKLELKWKSDHIPDDPRKEKEVIQNLQPSKHLEDLKIWNYNGTEFPSWVFDNSLSNLVFLKLNDCKYCLCLPPLGLLSSLKTLEITGFDGIVSVGAEFYGSNSSFASLEWLEFSNMKEWEEWECETTSFPRLQELYVGNCPKLKGTHLKKVVVSDELRISGNSMDTSHTDGGSDSLTIFRLHFFPKLRSLQLIDCQNLRRVSQE

superfamily: SSF52540
157-408 SSF52540

DGSASKVPSSSLVVESVIYGRDADIDIIINWLTSETNNPNQPSILSIVGMGGLGKTTLVQHVYSDPKIEDAKFDIKAWVCVSDHFHVLTVTRTILEAITNKKDDSGNLEMVHKKLKEKLLGKKFLLVLDDVWNERAVQWEAVQTPLSYGAPGSRILVTTRGEKVASSMRSEVHLLKQLRKDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLRTKSSISDWKNILESDIWELPKEH

Gene3D: G3DSA:3.40.50.300
176-301 G3DSA:3.40.50.300

GRDADIDIIINWLTSETNNPNQPSILSIVGMGGLGKTTLVQHVYSDPKIEDAKFDIKAWVCVSDHFHVLTVTRTILEAITNKKDDSGNLEMVHKKLKEKLLGKKFLLVLDDVWNERAVQWEAVQTP

HMMPfam: PF00931
IPR002182
178-459 NB-ARC,NBS
NB-ARC

DADIDIIINWLTSETNNPNQPSILSIVGMGGLGKTTLVQHVYSDPKIEDAKFDIKAWVCVSDHFHVLTVTRTILEAITNKKDDSGNLEMVHKKLKEKLLGKKFLLVLDDVWNERAVQWEAVQTPLSYGAPGSRILVTTRGEKVASSMRSEVHLLKQLRKDECWKVFENHALKDGDLELNDELMKVGRRIVEKCKGLPLALKTIGCLLRTKSSISDWKNILESDIWELPKEHCEIIPALFLSYRYLPSHLKRCFAYCALFPKDYEFVKKELILMWMAQNFLQS

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

ILSIVGMGGLGKTTLV

FPrintScan: PR00364
IPR000767
274-288 DISEASERSIST
Disease resistance protein

KLLGKKFLLVLDDVW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CKGLPLALKTIGCLL

superfamily: SSF52058
493-872 SSF52058,LRR

VMHDLLNDLAKYVCADFCFRLKFDKGRRIPKTARHFSFKFSDIKSFDGFGSLTDAKRLRSFLPISQCWDSQWNFKISIHDLFSKIKFIRMLSLRCSFLREVPDSVGDLKHLHSLDLSSTAIQKLPDSICLLYNLLILKLNQCFMLEELPINLHKLTKLRCLEFEGTRVSKMPMHFGELKNLQVLNPFFVDRNSELSTKQLGGLNQHGRLSINDVQNILNPLDALEANVKDKHLVKLELKWKSDHIPDDPRKEKEVIQNLQPSKHLEDLKIWNYNGTEFPSWVFDNSLSNLVFLKLNDCKYCLCLPPLGLLSSLKTLEITGFDGIVSVGAEFYGSNSSFASLEWLEFSNMKEWEEWECETTSFPRLQELYVGNCPKLKGTH

Gene3D: G3DSA:3.80.10.10
566-687 G3DSA:3.80.10.10

FKISIHDLFSKIKFIRMLSLRCSFLREVPDSVGDLKHLHSLDLSSTAIQKLPDSICLLYNLLILKLNQCFMLEELPINLHKLTKLRCLEFEGTRVSKMPMHFGELKNLQVLNPFFVDRNSEL

FPrintScan: PR00364
IPR000767
598-614 DISEASERSIST
Disease resistance protein

GDLKHLHSLDLSSTAIQ

ProfileScan: PS51450
IPR001611
602-623 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLHSLDLSSTAIQKLPDSICLL

Gene3D: G3DSA:3.80.10.10
745-889 G3DSA:3.80.10.10

KEVIQNLQPSKHLEDLKIWNYNGTEFPSWVFDNSLSNLVFLKLNDCKYCLCLPPLGLLSSLKTLEITGFDGIVSVGAEFYGSNSSFASLEWLEFSNMKEWEEWECETTSFPRLQELYVGNCPKLKGTHLKKVVVSDELRISGNSM

Gene3D: G3DSA:3.80.10.10
891-1085 G3DSA:3.80.10.10

TSHTDGGSDSLTIFRLHFFPKLRSLQLIDCQNLRRVSQEYAHNHLMNLSIDDCPQFKSFLFPKPMQIMFPSLTLLHITMCPEVELFPDGGLPLNVRYMTLSCLKLIASLRENLDPNTCLQSLTIQQLEVECFPDEVLLPRSLISLSIYSCSNLKKMHYKGLCHLSSLSLLFCPSLECLPAEGLPKSISSLEIFNC

superfamily: SSF52058
959-1105 SSF52058,LRR

FPSLTLLHITMCPEVELFPDGGLPLNVRYMTLSCLKLIASLRENLDPNTCLQSLTIQQLEVECFPDEVLLPRSLISLSIYSCSNLKKMHYKGLCHLSSLSLLFCPSLECLPAEGLPKSISSLEIFNCPLLKERCQSPDGEDWEKIAH


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox