PRGDB00063647 (truncated ATPase)

From PRG Wiki
Jump to: navigation, search
truncated ATPase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342065 (FJ817289)
Gene Class Unknown
Domain Type
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC 48-B10, complete sequence.

DNA Sequence

ATGAATCTTGACGGAGAAACTAATCTGATATTAAAGCATGCTTTGGAGGTGACAACTCATCTTCATGATGAAAAATCTCTCCAAAAGTTCAGGGCCATGGTTAAATGTGAGGATCCTAATGAAAATCTGTACTCATTTATTGGAACTTTACAACATGATGGTAAAGAATATCCTCTTTCCTTGCAGCAGATCCTGTTAAGAGATTCTAAGTTGAAAAACACTTATGTTCAGAAATTCTTTCGAAAAGCATGTTATTCAAAAGGACTTAAAGTTGATGATGCTTAA


Protein sequences

Name Description Sequence
truncated ATPase truncated ATPase [Phaseolus vulgaris].

MNLDGETNLILKHALEVTTHLHDEKSLQKFRAMVKCEDPNENLYSFIGTLQHDGKEYPLSLQQILLRDSKLKNTYVQKFFRKACYSKGLKVDDA



List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox