PRGDB00063654 (disease resistance-like protein GS6-1)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS6-1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037382 (AF403286)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS6-1 gene, partial cds.

DNA Sequence

GCTGGATAGTTGTGGAATTGTTCAGTTACGATGTAGCTTAGCCATGATGCCCAAACTGTCTGCATTCAAATTTGTAAATTGCAACAGGTGGCAATGGGTAGAATCGGAAGAAGCTGAAGAAAAAGTGGGCTCAATAATATCTTCAGAGGCACGTTTTTGGACACATTCGTTTTCTGCCAAGAATTGCAATCTATGTGATGATTTTTTTTTAACAGGTTTCAAGAAGTTTGCTCATGTAGGATATTTAAATCTATCGAGGAATAATTTCACAATCCTTCCTGAATTCTTCAAAGAATTGCAATTTTTAGGAAGTCTTAACGTGAGTCATTGCAAGCATCTTCAGGAAATTAGAGGGCTTCCACCAAACTTAAAGCATTTCNATGCAAGAAACTGTGCATCCTTGACTTCC


Protein sequences

Name Description Sequence
disease resistance-like protein GS6-1 disease resistance-like protein GS6-1 [Glycine max].

LDSCGIVQLRCSLAMMPKLSAFKFVNCNRWQWVESEEAEEKVGSIISSEARFWTHSFSAKNCNLCDDFFLTGFKKFAHVGYLNLSRNNFTILPEFFKELQFLGSLNVSHCKHLQEIRGLPPNLKHFXARNCASLTS


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
60-133 G3DSA:3.80.10.10

KNCNLCDDFFLTGFKKFAHVGYLNLSRNNFTILPEFFKELQFLGSLNVSHCKHLQEIRGLPPNLKHFXARNCAS

superfamily: SSF52058
61-136 SSF52058,LRR

NCNLCDDFFLTGFKKFAHVGYLNLSRNNFTILPEFFKELQFLGSLNVSHCKHLQEIRGLPPNLKHFXARNCASLTS

HMMPfam: PF00560
IPR001611
81-98 LRR_1
Leucine-rich repeat

YLNLSRNNFTILPEFFKE

HMMPfam: PF00560
IPR001611
104-125 LRR_1
Leucine-rich repeat

SLNVSHCKHLQEIRGLPPNLKH


List of References

A. Graham, F. Marek, C. Shoemaker
PCR Sampling of disease resistance-like sequences from a disease resistance gene cluster in soybean.
Theor. Appl. Genet.: 2002, 105(1);50-57
PubMed:12582561 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox