PRGDB00063661 (disease resistance-like protein GS4B-2)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS4B-2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037368 (AF403279)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS4B-2 gene, partial cds.

DNA Sequence

GTCTGGATTTCTCCATATCTGACAAAGAACAGACAGTGGAATGGAACCAAAACGCCTTCATGAAGATGGAAAACCTTAAAATCCTTATTATTAGAAATGGCAAATTTTCCAAAGGTCCCAATTATTTTCCAGAAGGTTTAAGAGTACTGGAATGGCACAGATATCCTTCAAATTGTTTACCATCTAACTTTGATCCTATCAACCTTGTTATATGCAAGTTACCTGACAGCTCCATTACGTCATTTGAGTTCCATGGCTCATCCAAGGCAATTTTAAATTTTGACCGGTGCGAATTTTTAACAAAGATACCTGATGTATCTGATCTCCCAAATTTGAAGGAACTTTCATTTAATTGGTGTGAGAGTTTAGTTGCAGTTGATGACTCAATTGGTTTTCTGAATAAACTTAAAACATTGAGTGCTTATGGTTGCAGG


Protein sequences

Name Description Sequence
disease resistance-like protein GS4B-2 disease resistance-like protein GS4B-2 [Glycine max].

LDFSISDKEQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSITSFEFHGSSKAILNFDRCEFLTKIPDVSDLPNLKELSFNWCESLVAVDDSIGFLNKLKTLSAYGCR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-143 PTHR11017:SF20,SUBFAMILY NOT NAMED

LDFSISDKEQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSITSFEFHGSSKAILNFDRCEFLTKIPDVSDLPNLKELSFNWCESLVAVDDSIGFLNKLKTLSAYGC

HMMPanther: PTHR11017
1-143 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDFSISDKEQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSITSFEFHGSSKAILNFDRCEFLTKIPDVSDLPNLKELSFNWCESLVAVDDSIGFLNKLKTLSAYGC

Gene3D: G3DSA:3.80.10.10
10-143 G3DSA:3.80.10.10

QTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSITSFEFHGSSKAILNFDRCEFLTKIPDVSDLPNLKELSFNWCESLVAVDDSIGFLNKLKTLSAYGC

superfamily: SSF52058
16-144 SSF52058,LRR

QNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSITSFEFHGSSKAILNFDRCEFLTKIPDVSDLPNLKELSFNWCESLVAVDDSIGFLNKLKTLSAYGCR


List of References

A. Graham, F. Marek, C. Shoemaker
PCR Sampling of disease resistance-like sequences from a disease resistance gene cluster in soybean.
Theor. Appl. Genet.: 2002, 105(1);50-57
PubMed:12582561 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox