PRGDB00063663 (disease resistance-like protein GS4-7)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS4-7
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037364 (AF403277)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS4-7 gene, partial cds.

DNA Sequence

GGAAGTGCAAGAGATTATTTAAAATTGAAATCATATATGTGGATTTCTCCATATCTGACAAAGAAGAAACAGTGGAATGGAATGAAAACGCCTTCATGAAGATGGAAAACCTTAAAATACTTATTATTAGAAATGGAAAATTTTCCAAAGGTCCCAATTATTTTCCACAAGGTTTGAGAGTACTGGAATGGCACAGATATCCTTCAAATTGTTTACCGTCTAACTTTGATCCGATCAACCTTGTTATATGCAAGTTACCTGACAGTTCCATTACGTCATTTGAGTTCC


Protein sequences

Name Description Sequence
disease resistance-like protein GS4-7 disease resistance-like protein GS4-7 [Glycine max].

KCKRLFKIEIIYVDFSISDKEETVEWNENAFMKMENLKILIIRNGKFSKGPNYFPQGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSITSFEF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
9-90 PTHR11017:SF20,SUBFAMILY NOT NAMED

EIIYVDFSISDKEETVEWNENAFMKMENLKILIIRNGKFSKGPNYFPQGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSI

HMMPanther: PTHR11017
9-90 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EIIYVDFSISDKEETVEWNENAFMKMENLKILIIRNGKFSKGPNYFPQGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSI


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox