PRGDB00063665 (disease resistance-like protein GS4-5)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS4-5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037360 (AF403275)
Gene Class Unknown
Domain Type
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS4-5 gene, partial cds.

DNA Sequence

GGAAGTGCAAGAGATTATTTAAAATTGAAATCATATGTGTGGATTTCTCAATATCTGACAAAGAAGAAACAGTGGAATGGAATGAAAACGCCTTCATGAAGATGGAAAACCTTAAAATACTTATTATTAGAAATGGCAAATTTTCCAAAGGTCCCAGTTATTTTCCAGAAGGTTTGAGAGTACTGGAATGGCACAGATATCCTTCAAATTGTTTACCATCGAACTTTGATCCGATGAACCTTGTTATATGCAAGTTACCTAACAGTTCCATTACGTCATTTGAGTTCC


Protein sequences

Name Description Sequence
disease resistance-like protein GS4-5 disease resistance-like protein GS4-5 [Glycine max].

KCKRLFKIEIICVDFSISDKEETVEWNENAFMKMENLKILIIRNGKFSKGPSYFPEGLRVLEWHRYPSNCLPSNFDPMNLVICKLPNSSITSFEF



List of References

A. Graham, F. Marek, C. Shoemaker
PCR Sampling of disease resistance-like sequences from a disease resistance gene cluster in soybean.
Theor. Appl. Genet.: 2002, 105(1);50-57
PubMed:12582561 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox