PRGDB00063669 (disease resistance-like protein GS4-1)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS4-1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037352 (AF403271)
Gene Class Unknown
Domain Type
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS4-1 gene, partial cds.

DNA Sequence

GGAAGTGCAAGAGATTATTTAAAATTGAAATCATATGCCTGGATTTCTCCATATCTGACAAAGAAGAAACAGTGGAATGGAATGAAAACGCCTTCATGAAGATGAAAAACCTTAAAATACTTATTATTAGAAATTGCAAATTTTCCAAAGGTCCCAATTATTTTCCAGAAGGTTTAAGAGTACTGGAATGGCACAGATATCCTTCAAATTGTTTACCATCTAACTTTGATCCTATCAACCTTGTTATATGCAAGTTACCTGACAGTTCCATTACGTCATTTGAGTTCC


Protein sequences

Name Description Sequence
disease resistance-like protein GS4-1 disease resistance-like protein GS4-1 [Glycine max].

KCKRLFKIEIICLDFSISDKEETVEWNENAFMKMKNLKILIIRNCKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFDPINLVICKLPDSSITSFEF



List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox