PRGDB00063671 (disease resistance-like protein GS3B-1)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS3B-1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037347 (AF403268)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS3B-1 gene, partial cds.

DNA Sequence

CCAGTGATGAAATCCAAGAGATTCTAAAAGTAAGCTTTGATGCTTTGGGGGAAGAACAAAAGAATGTTTTTCTTGACATTGCTTGTTGCTTCAAAGGGTATGAATGGACAGAGGTTGATAATATACTCCGTGACCTTTATGGTAACTGCACGAAGCATCATATTGGGGTGTTGGTTGAAAAATCTCTCGTAAAGGTTAGCTGCTGTGATACTGTTGAAATGCACGACATGATCCAGGACATGGGTAGAGAAATTGAGCGGCAGAGATCACCAGAAGAGCCAGGGAAGTGCAAGAGATTATTTAAAATTGAAATCATATGTCTGGATTTCCTCATATCT


Protein sequences

Name Description Sequence
disease resistance-like protein GS3B-1 disease resistance-like protein GS3B-1 [Glycine max].

SDEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKSLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLFKIEIICLDFLIS

Domains

Domain Start-End Description Sequence

superfamily: SSF46785
2-110 SSF46785

DEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKSLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLFKIEIICLDFL

HMMPanther: PTHR11017:SF20
2-106 PTHR11017:SF20,SUBFAMILY NOT NAMED

DEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKSLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLFKIEIIC

HMMPanther: PTHR11017
2-106 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKSLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLFKIEIIC

Gene3D: G3DSA:1.10.10.10
IPR011991
4-68 Wing_hlx_DNA_bd
Winged helix-turn-helix transcription repressor DN

IQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKSLVKVSCC


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox