PRGDB00063675 (disease resistance-like protein GS3-4)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS3-4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037339 (AF403264)
Gene Class NL
Domain Type NBS, LRR
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS3-4 gene, partial cds.

DNA Sequence

AATCAGAGTGCTGCTCTTCAATTGCTTACGTGGAATGCTTTTAAAAGAGAAAAAATTGATCCAAGTTATGAGGATGTCTTGAATCGTGTAGTAACTTATGCTTCTGGCCTTCCATTGGCTTTGGAAGTTATAGGTTCCAACTTGTTTGAAAAAACTGTAGCAGAATGGGAATCTGCTATGGAACATTATAAAAGAATTCCCAGTGATGAAATCCAAGAGATTCTAAAAGTAAGCTTTGATGCTTTGGGGGAAGAACAAAAGAATGTTTTTCTTGACATTGCTTGTTGCTTCAAAGGGTATGAATGGACAGAGGTTGATAATATACTCCGTGACCTTTATGGTAACTGCACGAAGCATCATATTGGGGTGTTGGTTGAAAAAYCTCTCGTAAAGGTTAGCTGCTGTGATACTGTTGAAATGCACGACATGATCCAGGACATGGGTAGAGAAATTGAGCGGCAGAGATCACCAGAAGAGCCAGGGAAGTGCAAGAGATTATTGTTACCAAAAGATATCATTCAAGTTTTAAAAGACAACACGGTGAGTGAG


Protein sequences

Name Description Sequence
disease resistance-like protein GS3-4 disease resistance-like protein GS3-4 [Glycine max].

NQSAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFEKTVAEWESAMEHYKRIPSDEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKXLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLLLPKDIIQVLKDNTVSE


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-183 PTHR11017:SF20,SUBFAMILY NOT NAMED

NQSAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFEKTVAEWESAMEHYKRIPSDEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKXLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLLLPKDIIQVLKDNTVSE

HMMPanther: PTHR11017
1-183 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

NQSAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFEKTVAEWESAMEHYKRIPSDEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKXLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLLLPKDIIQVLKDNTVSE

HMMPfam: PF00931
IPR002182
4-104 NB-ARC,NBS
NB-ARC

AALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFEKTVAEWESAMEHYKRIPSDEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTE

superfamily: SSF46785
69-177 SSF46785

DEIQEILKVSFDALGEEQKNVFLDIACCFKGYEWTEVDNILRDLYGNCTKHHIGVLVEKXLVKVSCCDTVEMHDMIQDMGREIERQRSPEEPGKCKRLLLPKDIIQVLK


List of References

A. Graham, F. Marek, C. Shoemaker
PCR Sampling of disease resistance-like sequences from a disease resistance gene cluster in soybean.
Theor. Appl. Genet.: 2002, 105(1);50-57
PubMed:12582561 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox