PRGDB00063681 (disease resistance-like protein GS2-1)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein GS2-1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22037326 (AF403257)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Glycine max

Comment?

Glycine max disease resistance-like protein GS2-1 gene, partial cds.

DNA Sequence

TTGTCCATATCATAGGGATCCATGGAATGGGCGGGTTAGGAAAAACAACACTTGCTCTGGCAGTTCATAATTTCATTGCTCTCCATTTCGATGAATCCTGTTTTCTTCAAAATGTGAGAGAAGAATCAAATAAACATGGGTTAAAACACCTTCAAAGCATCCTTCTTTCAAAATTACTTGGGGAGAAGGACATCACCTTAACAAGTTGGCAAGAAGGAGCTTCAATGATACAACATAGGCTCCAACGAAAGAAGGTTCTCTTGATTTTAGATGATGTTGATAAGCGCCAGCAATTAAAGGCTATTGTTGGAAGACCTGATTGGTTTGGTCCCGGTAGCAGAGTCATCATTACCACTCGGGACAAACATCTGCTAAAATATCATGAGGTTGAAAGAACCTATGAGGTGAAGGTTTTAAATCAGAGTGCTGCTCTTCAATTGCTTACGTGGAATGCTTTTAAAAGAGAAAAAATTGATCCAAGTTATGAGGATGTCTTGAATCGTG


Protein sequences

Name Description Sequence
disease resistance-like protein GS2-1 disease resistance-like protein GS2-1 [Glycine max].

VHIIGIHGMGGLGKTTLALAVHNFIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKRQQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLTWNAFKREKIDPSYEDVLNR

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-153 SSF52540

VHIIGIHGMGGLGKTTLALAVHNFIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKRQQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLTWNAFK

HMMPanther: PTHR11017:SF20
1-164 PTHR11017:SF20,SUBFAMILY NOT NAMED

VHIIGIHGMGGLGKTTLALAVHNFIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKRQQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLTWNAFKREKIDPSYEDV

HMMPanther: PTHR11017
1-164 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VHIIGIHGMGGLGKTTLALAVHNFIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKRQQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLTWNAFKREKIDPSYEDV

HMMPfam: PF00931
IPR002182
2-166 NB-ARC,NBS
NB-ARC

HIIGIHGMGGLGKTTLALAVHNFIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKRQQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLTWNAFKREKIDPSYEDVLN

Gene3D: G3DSA:3.40.50.300
3-125 G3DSA:3.40.50.300

IIGIHGMGGLGKTTLALAVHNFIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKRQQLKAIVGRPDWFGPGSRVIITTRDKHLLK

FPrintScan: PR00364
IPR000767
3-18 DISEASERSIST
Disease resistance protein

IIGIHGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
79-93 DISEASERSIST
Disease resistance protein

RLQRKKVLLILDDVD


List of References

A. Graham, F. Marek, C. Shoemaker
PCR Sampling of disease resistance-like sequences from a disease resistance gene cluster in soybean.
Theor. Appl. Genet.: 2002, 105(1);50-57
PubMed:12582561 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox