PRGDB00063692 (AT5g45560/MFC19_23)

From PRG Wiki
Jump to: navigation, search
AT5g45560/MFC19_23
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18086358 (AY064989)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana AT5g45560/MFC19_23 mRNA, complete cds.

DNA Sequence

ATGTCTAAAGTTGTGTATGAAGGATGGATGGTAAGGTATGGAAGAAGAAAGATCGGACGATCGTATATTCATATGAGGTATTTCGTGTTGGAGCCTCGTCTTTTGGCTTATTACAAGAAGAAGCCTCAAGATAATCAGCTTCCTATCAAGACGATGGTTATTGATGGAAACTGTAGAGTTGAGGATCGTGGCTTGAAGACACATCATGGACATATGGTTTATGTGTTGTCTATTTATAACAAGAAAGAAAAGCACCACAGAATCACGATGGCAGCTTTCAACATCCAGGAAGCTTTAATGTGGAAGGAGAAAATTGAGTGTGTCATAGATCAGCATCAAGACTCCCTAGTTCCAAGTGGTCAGCAATATGTTTCTTTTGAATATAAACCTGGAATGGACGCTGGAAGGACCGCTTCATCTTCAGATCATGAAAGCCCGTTCAGTGCGCTGGAGGATGAAAATGACTCTCAGCGTGATTTATTAAGGAGGACAACTATTGGAAATGGCCCTCCAGAATCTATACTTGACTGGACTAAAGAGTTTGATGCTGAGTTGTCAAACCAGAGTTCCAGCAACCAAGCGTTTTCGAGAAAACACTGGCGTCTCCTTCAGTGCCAAAATGGTCTACGGATTTTTGAAGAGCTACTTGAAGTTGATTATCTTCCAAGAAGCTGCAGCAGGGCTATGAAGGCTGTTGGTGTTGTAGAGGCCACATGTGAAGAGATATTCGAGCTTGTGATGAGCATGGATGGCACTCGATATGAGTGGGACTGCAGTTTTCATAATGGAAGATTAGTGGAAGAGGTCGATGGTCACACAGCAATACTCTATCACAGACTTCTGCTCGACTGGTTTCCAATGGTTGTATGGCCTCGTGACCTCTGCTATGTACGTTATTGGCGACGTAATGACGATGGAAGTTATGTGGTATTGTTTCGTTCTAGGGAGCATGAAAATTGTGGTCCACAACCTGGATTTGTGCGGGCTCATCTTGAGAGTGGAGGATTTAACATCGCCCCACTAAAGCCCCGGAATGGAAGGCCTAGGACACAAGTGCAACATCTAATACAAATCGATCTGAAAGGGTGGGGTTCAGGTTATCTTCCAGCATTTCAACAACATTGTCTTCTTCAAATGCTGAACAGTGTTTCTGGTTTGCGTGAGTGGTTCTCACAGACAGATGATAGAGGTCAACCGATCAGGATCCCTGTTATGGTTAATATGGCATCTTCTTCCTTAGCGTTGGGTAAAGGTGGAAAGCATCACCATAAGTCTTCCCTTTCTATTGATCAAACAAATGGTGCCAGCAGAAACTCTGTGCTAATGGATGAAGACTCGGATGACGATGACGAGTTTCAGATACCTGATTCAGAACCAGAGCCTGAAACGAGTAAGCAGGATCAGGAGACTGATGCCAAGAAAACAGAGGAACCTGCTCTCAACATTGATCTGTCATGTTTCTCGGGTAATCTGCGACACGATGATAACGAAAATGCCCGTAACTGCTGGAGGATTTCTGATGGGAACAACTTTAAAGTCCGTGGCAAGAGTTTCTGTGACGATAAAAGGAAGATTCCTGCTGGGAAGCATCTAATGGATCTTGTCGCCGTCGATTGGTTCAAAGACACTAAAAGAATGGATCATGTGGTTAGACGCAAGGGCTGTGCTGCACAAGTTGCTGCAGAGAAAGGTCTTTTCTCAACGGTAGTAAATGTTCAAGTTCCTGGATCAACACACTATAGTATGGTATTTTATTTCGTGACTAAAGAACTTGTACCTGGATCACTCTTCCAACGTTTTGTTGATGGTGATGACGAATTTCGTAATAGCAGGCTCAAGCTTATACCTTTAGTCCCAAAGGGTTCATGGATAGTAAGGCAAAGCGTGGGAAGCACTCCGTGTCTCCTCGGGAAAGCAGTAGATTGCAACTATATCCGTGGTCCAACATACTTAGAAATAGATGTAGATATCGGCTCATCCACAGTCGCAAATGGAGTTCTTGGTCTTGTCATCGGCGTAATCACATCTTTGGTTGTCGAAATGGCTTTCCTTGTACAGGCGAATACACCAGAAGAATTGCCCGAGCGGCTTATCGGGGCGGTGAGGGTTTCTCATGTAGAGCTATCATCGGCTATAGTTCCCAATTTGGATTCAGATTAG


Protein sequences

Name Description Sequence
AT5g45560/MFC19_23 AT5g45560/MFC19_23 [Arabidopsis thaliana].

MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRVEDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVIDQHQDSLVPSGQQYVSFEYKPGMDAGRTASSSDHESPFSALEDENDSQRDLLRRTTIGNGPPESILDWTKEFDAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVMVNMASSSLALGKGGKHHHKSSLSIDQTNGASRNSVLMDEDSDDDDEFQIPDSEPEPETSKQDQETDAKKTEEPALNIDLSCFSGNLRHDDNENARNCWRISDGNNFKVRGKSFCDDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQVAAEKGLFSTVVNVQVPGSTHYSMVFYFVTKELVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQANTPEELPERLIGAVRVSHVELSSAIVPNLDSD


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRVEDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVIDQHQDSLVPSGQQYVSFEYKPGMDAGRTASSSDHESPFSALEDENDSQRDLLRRTTIGNGPPESILDWTKEFDAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVM

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRVEDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVIDQHQDSLVPSGQQYVSFEYKPGMDAGRTASSSDHESPFSALEDENDSQRDLLRRTTIGNGPPESILDWTKEFDAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVM

Gene3D: G3DSA:2.30.29.30
IPR011993
2-115 PH_type
Pleckstrin homology-type

SKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRVEDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVIDQHQDS

superfamily: SSF50729
3-118 SSF50729

KVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRVEDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVIDQHQDSLVP

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRVEDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVID

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRVEDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVIDQH

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EFDAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQ

superfamily: SSF55961
192-393 SSF55961

NQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQT

Gene3D: G3DSA:3.30.530.20
IPR023393
194-393 G3DSA:3.30.530.20
START-like domain

AFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQT

ProfileScan: PS50848
IPR002913
200-372 START
Lipid-binding START

WRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWGSGYLPAFQ

HMMPfam: PF01852
IPR002913
226-364 START
Lipid-binding START

SRAMKAVGVVEATCEEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWG

HMMPfam: PF07059
IPR009769
503-707 DUF1336
Domain of unknown function DUF1336

WRISDGNNFKVRGKSFCDDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQVAAEKGLFSTVVNVQVPGSTHYSMVFYFVTKELVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQANTPEELPERLIGAVRVSHVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox