PRGDB00063761 (putative LRR-kinase protein)

From PRG Wiki
Jump to: navigation, search
putative LRR-kinase protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 222446475 (AB379821)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group KINt1 mRNA for putative LRR-kinase protein, complete cds.

DNA Sequence

ATGGCGATACGTCGGATGAGGCTTGCATTGTCCCTCCTCTGCGTCCTGATGACGATCGGCACCGGCACGGCAAGCGATGAGCCGGCGCTGCTTGCTCTCAAGGCAGGGCTCAGCGGGAGCATCTCAAGTGCGCTCGCCTCATGGAACACCAGCGCCAGCTTCTGCGGCTGGGAGGGCGTGACATGCAGCCGCCGGTGGCCGACGAGGGTGGCGGCGCTGGACCTGCCGTCGAGCAACCTCACCGGCACGCTCCCGCCGGCCGTCGGGAACCTCACCTTCCTACGGCGGCTCAACCTGAGCTCCAACCAGCTGCACGGCGAGATTCCTCCGGCCGTCGGCCGGCTCCGGCGTCTCCTGGTCCTCGACATGGACCACAACTCCTTCTCAGGTGCGATCCCTGCTAATCTGAGCTCCTGCATCAGCTTGACAATCCTGCGGATCCAGTCCAACCCGCAGCTTGGCGGGCGAATCCCTCCGGAGCTCGGGAACACGCTGCCACGGCTCGAGAAGCTTCAGCTCAGGAAGAACAGCTTAACAGGGAAGATCCCGGCCTCGCTAGCCAACCTTTCGTCGTTGCAGCTCTTGTCTCTGAGTTACAACAAGCTTGAGGGTCTCATCCCTCCAGGCCTCGGCGATATCGCAGGTCTGCGTTATCTTTTTCTCAATGCAAACAACCTTTCCGGCGAACTTCCGATATCTCTGTACAATTTGTCGTCGCTGGTGATGCTCCAGGTTGGCAATAACATGCTGCATGGAAGCATCCCTTCTGACATTGGTCGCATGCTTCCCGGTATACAAGTGTTTGGATTGAATGTTAACCGGTTTACAGGAGTCATCCCTCCTTCTCTCTCCAATCTTTCAACACTCACGGATCTGTACCTCTCAGACAACAAATTCACCGGATTTGTGCCTCCCAACTTGGGGAGGTTGCAATATCTTCAGCATTTGTATTTGGTAGGAAATCAACTTGAGGCAGATAACACCAAGGGCTGGGAATTTCTCACTTCACTGTCAAACTGCAGCCAGCTGCAAGTATTTGTCCTCGCTAACAACTCTTTCAGTGGGCAGCTGCCAAGGCCAATTGGGAACCTGTCAACGACGCTACGAATGCTCAATTTAGAGAACAACAATATCTCGGGGAGCATACCTGAGGACATTGGCAATCTGGTAGGCTTAAGCTTTCTCGATCTGGGGTTCAATTCCATATTATCTGGAGTGATTCCTGAAAGCATTGGAAAGCTAACAAACTTGGTCGAAATTTCCCTGTACAATACCAGCCTGTCAGGCCTCATACCGGCATCTATTGGAAATCTTACAAATTTGAATAGGATATACGCATTCTACTGCAATTTGGAAGGTCCAATCCCACCAAGCATTGGGGATCTAAAAAAACTGTTTGTTCTAGATTTGTCATACAACCATCTAAATGGTTCGATCCCCAAAGATATTTTTGAGCTGCAGTCACTCTCGTGGTTCTTGGACTTGTCATATAATTCTCTGTCAGGACCCCTTCCATCAGAAGTTGGTAGCTTGGTTAACCTAAATGGAATGGATCTATCCGGAAACCAGCTATCTGGACAAATACCTGACAGTATAGGAAATTGTGAGGTGATGGAAGCCCTCTATCTAGAAGAGAACTCATTTGAAGGAGGAATACCACAATCTTTGAGCAACCTAAAAGGGCTCACCGTACTGAACCTAACCATGAATAAGTTATCTGGCAGGATCCCCGACACCATTGCTAGGATTCCCAATCTGCAACAGCTGTTTCTAGCACACAACAATTTTTCAGGACCAATCCCAGCAACTCTACAAAATTTGACAACGCTGTGGCAATTAGATGTGTCCTTCAACAAATTGCAAGGGGAAGTTCCAGTTAAGGGTGTTTTCAGAAACCTGACTTTTGCATCGGTTGTGGGGAATAACTTGTGCGGTGGAATACCCCAGCTTCACTTGGCTCCATGTCCCATTCTCAATGTAAGCAAGAACAGAAACCAGCATCTGAAGTCTCTTGCAATAGCTCTGCCAACAACGGGTGCAATATTGGTGTTAGTTTCTGCTATTGTAGTTATTCTGTTACACCAAAGGAAGTTCAAACAAAGACAAAATAGACAAGCAACATCCCTGGTTATTGAGGAACAGTATCAAAGGGTTTCATATTATGCATTATCAAGAGGAAGTAATGAATTTTCAGAAGCCAACCTGCTTGGCAAAGGAAGATATGGTTCTGTTTTTAGATGTACTTTAGACGATGAGAGTGCACTTGTTGCTGTAAAAGTGTTCGACCTTCAACAATCAGGATCTTCAAAAAGCTTTGAGGCTGAATGTGAGGCTCTGAGAAGAGTACGCCACCGTTGTCTCATAAAGATCATCACTTGTTGCTCAAGTATTGGTCCACAGGGTCAAGAGTTCAAGGCATTGGTTTTTGAGTTCATGCCCAATGGTAGCTTGGATGGTTGGATTCATCCCAAGTCAAGCAATCTCACTCCTAGCAATACACTCAGCCTTTCACAGAGACTCAACATTGCTGTTGATATCTTTGATGCACTGGATTATCTTCACAATCACTGCCAGCCACCAATCATACACTGTGATCTGAAGCCTAGTAATATTCTTCTATCAGAAGACAAGAGTGCTAAGGTTGGAGATTTTGGCATATCAAGAATCCTCCCGAAAAGTAGTACTAAAACTCTTCAAAGTTCGAAAAGCTCAATTGGAATCAGAGGTTCCATTGGTTATATTGCACCAGAGTATGGGGAAGGGTCTACAATAACCAGAGCAGGCGATACTTACAGCTTAGGCATATTGTTGCTTGAGATGTTTACTGGAAGGAGCCCTACTGATGACATTTTCAGGGATTCAATGGATCTGCACAAGTTTGTTGCAGCTTCTTTTCTTCACCAACCCCTAGACATAGCTGATCCAACAATCTGGCTTCATGAAGAAGAAAATGTTGCAGATGTTAAAAATGAAAGCATAAAAACAAGAATTATTCAACAGTGCTTGGTGTCTGTTCTTAGGCTCGGCATATCATGCTCAAAGCAACAACCCAGAGAGCGAATGATGTTGGCAGAAGCTGTATCAGAGATGCATGCAACCAGAGATGAATATCTCAGGTCTTGGATGGTCGGCCATGAAGAACATAGCACTGTGAGCTAA


Protein sequences

Name Description Sequence
putative LRR-kinase protein putative LRR-kinase protein [Oryza sativa Japonica Group].

MAIRRMRLALSLLCVLMTIGTGTASDEPALLALKAGLSGSISSALASWNTSASFCGWEGVTCSRRWPTRVAALDLPSSNLTGTLPPAVGNLTFLRRLNLSSNQLHGEIPPAVGRLRRLLVLDMDHNSFSGAIPANLSSCISLTILRIQSNPQLGGRIPPELGNTLPRLEKLQLRKNSLTGKIPASLANLSSLQLLSLSYNKLEGLIPPGLGDIAGLRYLFLNANNLSGELPISLYNLSSLVMLQVGNNMLHGSIPSDIGRMLPGIQVFGLNVNRFTGVIPPSLSNLSTLTDLYLSDNKFTGFVPPNLGRLQYLQHLYLVGNQLEADNTKGWEFLTSLSNCSQLQVFVLANNSFSGQLPRPIGNLSTTLRMLNLENNNISGSIPEDIGNLVGLSFLDLGFNSILSGVIPESIGKLTNLVEISLYNTSLSGLIPASIGNLTNLNRIYAFYCNLEGPIPPSIGDLKKLFVLDLSYNHLNGSIPKDIFELQSLSWFLDLSYNSLSGPLPSEVGSLVNLNGMDLSGNQLSGQIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTVLNLTMNKLSGRIPDTIARIPNLQQLFLAHNNFSGPIPATLQNLTTLWQLDVSFNKLQGEVPVKGVFRNLTFASVVGNNLCGGIPQLHLAPCPILNVSKNRNQHLKSLAIALPTTGAILVLVSAIVVILLHQRKFKQRQNRQATSLVIEEQYQRVSYYALSRGSNEFSEANLLGKGRYGSVFRCTLDDESALVAVKVFDLQQSGSSKSFEAECEALRRVRHRCLIKIITCCSSIGPQGQEFKALVFEFMPNGSLDGWIHPKSSNLTPSNTLSLSQRLNIAVDIFDALDYLHNHCQPPIIHCDLKPSNILLSEDKSAKVGDFGISRILPKSSTKTLQSSKSSIGIRGSIGYIAPEYGEGSTITRAGDTYSLGILLLEMFTGRSPTDDIFRDSMDLHKFVAASFLHQPLDIADPTIWLHEEENVADVKNESIKTRIIQQCLVSVLRLGISCSKQQPRERMMLAEAVSEMHATRDEYLRSWMVGHEEHSTVS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
8-1048 PTHR24420:SF474,SUBFAMILY NOT NAMED

LALSLLCVLMTIGTGTASDEPALLALKAGLSGSISSALASWNTSASFCGWEGVTCSRRWPTRVAALDLPSSNLTGTLPPAVGNLTFLRRLNLSSNQLHGEIPPAVGRLRRLLVLDMDHNSFSGAIPANLSSCISLTILRIQSNPQLGGRIPPELGNTLPRLEKLQLRKNSLTGKIPASLANLSSLQLLSLSYNKLEGLIPPGLGDIAGLRYLFLNANNLSGELPISLYNLSSLVMLQVGNNMLHGSIPSDIGRMLPGIQVFGLNVNRFTGVIPPSLSNLSTLTDLYLSDNKFTGFVPPNLGRLQYLQHLYLVGNQLEADNTKGWEFLTSLSNCSQLQVFVLANNSFSGQLPRPIGNLSTTLRMLNLENNNISGSIPEDIGNLVGLSFLDLGFNSILSGVIPESIGKLTNLVEISLYNTSLSGLIPASIGNLTNLNRIYAFYCNLEGPIPPSIGDLKKLFVLDLSYNHLNGSIPKDIFELQSLSWFLDLSYNSLSGPLPSEVGSLVNLNGMDLSGNQLSGQIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTVLNLTMNKLSGRIPDTIARIPNLQQLFLAHNNFSGPIPATLQNLTTLWQLDVSFNKLQGEVPVKGVFRNLTFASVVGNNLCGGIPQLHLAPCPILNVSKNRNQHLKSLAIALPTTGAILVLVSAIVVILLHQRKFKQRQNRQATSLVIEEQYQRVSYYALSRGSNEFSEANLLGKGRYGSVFRCTLDDESALVAVKVFDLQQSGSSKSFEAECEALRRVRHRCLIKIITCCSSIGPQGQEFKALVFEFMPNGSLDGWIHPKSSNLTPSNTLSLSQRLNIAVDIFDALDYLHNHCQPPIIHCDLKPSNILLSEDKSAKVGDFGISRILPKSSTKTLQSSKSSIGIRGSIGYIAPEYGEGSTITRAGDTYSLGILLLEMFTGRSPTDDIFRDSMDLHKFVAASFLHQPLDIADPTIWLHEEENVADVKNESIKTRIIQQCLVSVLRLGISCSKQQPRERMMLAEAVSEMHATRDEYLRSWMVGHEEH

HMMPanther: PTHR24420
8-1048 PTHR24420,FAMILY NOT NAMED

LALSLLCVLMTIGTGTASDEPALLALKAGLSGSISSALASWNTSASFCGWEGVTCSRRWPTRVAALDLPSSNLTGTLPPAVGNLTFLRRLNLSSNQLHGEIPPAVGRLRRLLVLDMDHNSFSGAIPANLSSCISLTILRIQSNPQLGGRIPPELGNTLPRLEKLQLRKNSLTGKIPASLANLSSLQLLSLSYNKLEGLIPPGLGDIAGLRYLFLNANNLSGELPISLYNLSSLVMLQVGNNMLHGSIPSDIGRMLPGIQVFGLNVNRFTGVIPPSLSNLSTLTDLYLSDNKFTGFVPPNLGRLQYLQHLYLVGNQLEADNTKGWEFLTSLSNCSQLQVFVLANNSFSGQLPRPIGNLSTTLRMLNLENNNISGSIPEDIGNLVGLSFLDLGFNSILSGVIPESIGKLTNLVEISLYNTSLSGLIPASIGNLTNLNRIYAFYCNLEGPIPPSIGDLKKLFVLDLSYNHLNGSIPKDIFELQSLSWFLDLSYNSLSGPLPSEVGSLVNLNGMDLSGNQLSGQIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTVLNLTMNKLSGRIPDTIARIPNLQQLFLAHNNFSGPIPATLQNLTTLWQLDVSFNKLQGEVPVKGVFRNLTFASVVGNNLCGGIPQLHLAPCPILNVSKNRNQHLKSLAIALPTTGAILVLVSAIVVILLHQRKFKQRQNRQATSLVIEEQYQRVSYYALSRGSNEFSEANLLGKGRYGSVFRCTLDDESALVAVKVFDLQQSGSSKSFEAECEALRRVRHRCLIKIITCCSSIGPQGQEFKALVFEFMPNGSLDGWIHPKSSNLTPSNTLSLSQRLNIAVDIFDALDYLHNHCQPPIIHCDLKPSNILLSEDKSAKVGDFGISRILPKSSTKTLQSSKSSIGIRGSIGYIAPEYGEGSTITRAGDTYSLGILLLEMFTGRSPTDDIFRDSMDLHKFVAASFLHQPLDIADPTIWLHEEENVADVKNESIKTRIIQQCLVSVLRLGISCSKQQPRERMMLAEAVSEMHATRDEYLRSWMVGHEEH

superfamily: SSF52058
20-333 SSF52058,LRR

GTGTASDEPALLALKAGLSGSISSALASWNTSASFCGWEGVTCSRRWPTRVAALDLPSSNLTGTLPPAVGNLTFLRRLNLSSNQLHGEIPPAVGRLRRLLVLDMDHNSFSGAIPANLSSCISLTILRIQSNPQLGGRIPPELGNTLPRLEKLQLRKNSLTGKIPASLANLSSLQLLSLSYNKLEGLIPPGLGDIAGLRYLFLNANNLSGELPISLYNLSSLVMLQVGNNMLHGSIPSDIGRMLPGIQVFGLNVNRFTGVIPPSLSNLSTLTDLYLSDNKFTGFVPPNLGRLQYLQHLYLVGNQLEADNTKGWEF

HMMPfam: PF08263
IPR013210
25-63 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SDEPALLALKAGLSGSISSALASWNTSASFCGWEGVTCS

Gene3D: G3DSA:3.80.10.10
25-260 G3DSA:3.80.10.10

SDEPALLALKAGLSGSISSALASWNTSASFCGWEGVTCSRRWPTRVAALDLPSSNLTGTLPPAVGNLTFLRRLNLSSNQLHGEIPPAVGRLRRLLVLDMDHNSFSGAIPANLSSCISLTILRIQSNPQLGGRIPPELGNTLPRLEKLQLRKNSLTGKIPASLANLSSLQLLSLSYNKLEGLIPPGLGDIAGLRYLFLNANNLSGELPISLYNLSSLVMLQVGNNMLHGSIPSDIGR

HMMPfam: PF00560
IPR001611
94-111 LRR_1
Leucine-rich repeat

LRRLNLSSNQLHGEIPPA

HMMPfam: PF13855
166-226 LRR_8,Leucine rich repeat

PRLEKLQLRKNSLTGKIPASLANLSSLQLLSLSYNKLEGLIPPGLGDIAGLRYLFLNANNL

Gene3D: G3DSA:3.80.10.10
262-489 G3DSA:3.80.10.10

LPGIQVFGLNVNRFTGVIPPSLSNLSTLTDLYLSDNKFTGFVPPNLGRLQYLQHLYLVGNQLEADNTKGWEFLTSLSNCSQLQVFVLANNSFSGQLPRPIGNLSTTLRMLNLENNNISGSIPEDIGNLVGLSFLDLGFNSILSGVIPESIGKLTNLVEISLYNTSLSGLIPASIGNLTNLNRIYAFYCNLEGPIPPSIGDLKKLFVLDLSYNHLNGSIPKDIFELQSL

superfamily: SSF52058
336-402 SSF52058,LRR

SLSNCSQLQVFVLANNSFSGQLPRPIGNLSTTLRMLNLENNNISGSIPEDIGNLVGLSFLDLGFNSI

HMMPfam: PF00560
IPR001611
368-389 LRR_1
Leucine-rich repeat

LRMLNLENNNISGSIPEDIGNL

superfamily: SSF52058
403-653 SSF52058,LRR

LSGVIPESIGKLTNLVEISLYNTSLSGLIPASIGNLTNLNRIYAFYCNLEGPIPPSIGDLKKLFVLDLSYNHLNGSIPKDIFELQSLSWFLDLSYNSLSGPLPSEVGSLVNLNGMDLSGNQLSGQIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTVLNLTMNKLSGRIPDTIARIPNLQQLFLAHNNFSGPIPATLQNLTTLWQLDVSFNKLQGEVPVKGVFRNLTFASVVGNNLCGGIPQLHLA

HMMPfam: PF00560
IPR001611
465-485 LRR_1
Leucine-rich repeat

LFVLDLSYNHLNGSIPKDIFE

Gene3D: G3DSA:3.80.10.10
493-649 G3DSA:3.80.10.10

LDLSYNSLSGPLPSEVGSLVNLNGMDLSGNQLSGQIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTVLNLTMNKLSGRIPDTIARIPNLQQLFLAHNNFSGPIPATLQNLTTLWQLDVSFNKLQGEVPVKGVFRNLTFASVVGNNLCGGIPQ

HMMPfam: PF13855
514-572 LRR_8,Leucine rich repeat

LNGMDLSGNQLSGQIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTVLNLTMNKL

Gene3D: G3DSA:3.30.200.20
687-808 G3DSA:3.30.200.20

AIVVILLHQRKFKQRQNRQATSLVIEEQYQRVSYYALSRGSNEFSEANLLGKGRYGSVFRCTLDDESALVAVKVFDLQQSGSSKSFEAECEALRRVRHRCLIKIITCCSSIGPQGQEFKALV

superfamily: SSF56112
IPR011009
700-1030 Kinase_like
Protein kinase-like domain

QRQNRQATSLVIEEQYQRVSYYALSRGSNEFSEANLLGKGRYGSVFRCTLDDESALVAVKVFDLQQSGSSKSFEAECEALRRVRHRCLIKIITCCSSIGPQGQEFKALVFEFMPNGSLDGWIHPKSSNLTPSNTLSLSQRLNIAVDIFDALDYLHNHCQPPIIHCDLKPSNILLSEDKSAKVGDFGISRILPKSSTKTLQSSKSSIGIRGSIGYIAPEYGEGSTITRAGDTYSLGILLLEMFTGRSPTDDIFRDSMDLHKFVAASFLHQPLDIADPTIWLHEEENVADVKNESIKTRIIQQCLVSVLRLGISCSKQQPRERMMLAEAVSEM

ProfileScan: PS50011
IPR000719
730-1038 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEANLLGKGRYGSVFRCTLDDESALVAVKVFDLQQSGSSKSFEAECEALRRVRHRCLIKIITCCSSIGPQGQEFKALVFEFMPNGSLDGWIHPKSSNLTPSNTLSLSQRLNIAVDIFDALDYLHNHCQPPIIHCDLKPSNILLSEDKSAKVGDFGISRILPKSSTKTLQSSKSSIGIRGSIGYIAPEYGEGSTITRAGDTYSLGILLLEMFTGRSPTDDIFRDSMDLHKFVAASFLHQPLDIADPTIWLHEEENVADVKNESIKTRIIQQCLVSVLRLGISCSKQQPRERMMLAEAVSEMHATRDEYL

HMMPfam: PF00069
IPR000719
734-962 Pkinase,Ser-thr
Protein kinase, catalytic domain

NLLGKGRYGSVFRCTLDDESALVAVKVFDLQQSGSSKSFEAECEALRRVRHRCLIKIITCCSSIGPQGQEFKALVFEFMPNGSLDGWIHPKSSNLTPSNTLSLSQRLNIAVDIFDALDYLHNHCQPPIIHCDLKPSNILLSEDKSAKVGDFGISRILPKSSTKTLQSSKSSIGIRGSIGYIAPEYGEGSTITRAGDTYSLGILLLEMFTGRSPTDDIFRDSMDLHKFVA

PatternScan: PS00107
IPR017441
736-759 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGRYGSVFRCTLDDESALVAVK

Gene3D: G3DSA:1.10.510.10
809-1028 G3DSA:1.10.510.10

FEFMPNGSLDGWIHPKSSNLTPSNTLSLSQRLNIAVDIFDALDYLHNHCQPPIIHCDLKPSNILLSEDKSAKVGDFGISRILPKSSTKTLQSSKSSIGIRGSIGYIAPEYGEGSTITRAGDTYSLGILLLEMFTGRSPTDDIFRDSMDLHKFVAASFLHQPLDIADPTIWLHEEENVADVKNESIKTRIIQQCLVSVLRLGISCSKQQPRERMMLAEAVS

PatternScan: PS00108
IPR008271
861-873 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDLKPSNILL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox