PRGDB00063767 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 242081418 (XM_002445433)
Gene Class NL
Domain Type NBS, LRR
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA.

DNA Sequence

ATGACGACTACACGAATTGAAGATGTTGCTAAATATTGCAGCTTTCCACAAAATGAATATGTTTACCCTATGATGCCCCTTGATAGTAATGACTCAAAAAGCTTGTTATTGAAAAGGATATTTGACAATGAAGACGACCTCTCTCTTGAATTGAAAGAAGTTACTGATGATATACTAAAGAAATGTCATGGCTTACCACTAGCTATAGTTAATATTGCTAGCCTATTAGCAACCAAACCAATCTCTAAAATGGAGTGGGAGAGGGTGCGCGGTTCTCTTGGATCTGCACTTGAACAAGATCATGAGCTGGAATTAGTTAAAAAGATATTGTTTCTTAGTTACTGTGACCTACCTCACTATTTGAAGATATGTTTCTTGGATCTAAGCATATTTCCAGAGGATCATGTGATTGGCCGGTCCTGTTTAATAAGGAGATGGATAGCTGAAGGATTTATTGCACAACAACAAGGGCAACGCTTAGAGGATACTGCAGAAAACTACTTTAGTGAGCTCATGAATAGAAACATGATTGAACCAGTGGGCACTGACTATAGTGGAAGGCCAAGAGCCTGCCGGGTACATGATATAATGCTTGATCTTATTATATCATTATCAGTTAAAGAAAATTTTGTTACTATAATGGCTGATCATAAGTTGACACCATCGACTAACAAAATTCGGCGTCTCTCACTCCAAGGAAACTATGCAGATCAGAGTCTCAGGCTTGGGACGAACAGCTTGTCTCAAGTTCGGTCATTTAGTATATTTGGTGACGTCAGGAAGATACCCTCTCTCTTGGATTTTCAAGTTTTACGAGTCCTAGATATACAAAACTGTTCTAGCCTAGAGGACAGAGACATTGAAAATATTGGAAGTTTGATCCACTTGAGGTATTTAAGTCTCTATCATAGCAACATTGGTAATATCCCAACACAAATTGGAAAGCTAAAACATTTGCAGACACTCGATCTCAGAGCTACCAGAATAAAAAAGCTGCCAGCAACTATTGCTCAACTACACCAATTAGTGCGCCTATGTGTGCCTAATGGTGTACAATTGCCAAATGGGGTCGGTAATATGGCAGCTCTAGAGGAGCTTTCAATGTTGGATGCTAGCAAAAACTCCCCAGAAGTTGTGCAGGAGTTAGGATACCTAACCAAACTGAAGGTGCTTGGGATTAAGTGGTGTGCTGACAGTGCAATTAATGATGAAGGAAACTTTAAGAAGTCTTTGATCTCTTCGTTCTGTAATCTTGGAGAAAGAAACCTCCATTCTCTAAAGATTGAGACTACAGAACGTTGTTCTATGGATTTTTTGTTTGATTCATTGTGTCCTGATCCATGTTGTATGCAGAAGTTTAGCAACAGCCCCATTTTCTCTAGGCTCCCAAAGTGGATATCCTACCTCTCAGTACTCACCAACTTAGTTATTTTTATAGAAGAAGTGGGAGGTGGAGATGTGGATGTGCTCAAAGACTTGCCTGCACTACGCTGCCTCCAAATTTTTACAACAGAATACTTGCAGGAATCGCTCATCATCAGAGCTGGTGGATTCAAGTGTCTGGAGGATTTCCATTTCCGCCCTTCCATGTACTTAAAAAGGAAGAAGGGAATGATGAGCCTGATATTTGAAGCAGGAGCAATGCCAAGGCTCAACCGGCTTTGGTTTAGATTTGTTGTGCATGATACTCTATCTGCATATGGAGCCGGTTTTGACTTTGGCATTAGCCTCCTTTCCTCCCTCAAATGTCTCTGGGTCAGTATTAATTGTCGGGGTGCAACAGTTTGGGAGGTGGAGGTTGCCAAGGCCACCATTACAAATACAGCAGCTCAACTTCCCAACCGTCCAAAGCATGAAATCCATACATTTGGGGAAGAGGAGATGGTTGAGAATGAGGAGCAGGAGGAGGATAGCCATGCTGCAGGCCAATGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein SORBIDRAFT_07g020160 [Sorghum bicolor].

MTTTRIEDVAKYCSFPQNEYVYPMMPLDSNDSKSLLLKRIFDNEDDLSLELKEVTDDILKKCHGLPLAIVNIASLLATKPISKMEWERVRGSLGSALEQDHELELVKKILFLSYCDLPHYLKICFLDLSIFPEDHVIGRSCLIRRWIAEGFIAQQQGQRLEDTAENYFSELMNRNMIEPVGTDYSGRPRACRVHDIMLDLIISLSVKENFVTIMADHKLTPSTNKIRRLSLQGNYADQSLRLGTNSLSQVRSFSIFGDVRKIPSLLDFQVLRVLDIQNCSSLEDRDIENIGSLIHLRYLSLYHSNIGNIPTQIGKLKHLQTLDLRATRIKKLPATIAQLHQLVRLCVPNGVQLPNGVGNMAALEELSMLDASKNSPEVVQELGYLTKLKVLGIKWCADSAINDEGNFKKSLISSFCNLGERNLHSLKIETTERCSMDFLFDSLCPDPCCMQKFSNSPIFSRLPKWISYLSVLTNLVIFIEEVGGGDVDVLKDLPALRCLQIFTTEYLQESLIIRAGGFKCLEDFHFRPSMYLKRKKGMMSLIFEAGAMPRLNRLWFRFVVHDTLSAYGAGFDFGISLLSSLKCLWVSINCRGATVWEVEVAKATITNTAAQLPNRPKHEIHTFGEEEMVENEEQEEDSHAAGQ

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-156 NB-ARC,NBS
NB-ARC

MTTTRIEDVAKYCSFPQNEYVYPMMPLDSNDSKSLLLKRIFDNEDDLSLELKEVTDDILKKCHGLPLAIVNIASLLATKPISKMEWERVRGSLGSALEQDHELELVKKILFLSYCDLPHYLKICFLDLSIFPEDHVIGRSCLIRRWIAEGFIAQQQ

superfamily: SSF52540
1-101 SSF52540

MTTTRIEDVAKYCSFPQNEYVYPMMPLDSNDSKSLLLKRIFDNEDDLSLELKEVTDDILKKCHGLPLAIVNIASLLATKPISKMEWERVRGSLGSALEQDH

HMMPanther: PTHR11017:SF126
20-428 PTHR11017:SF126,OS11G0237600 PROTEIN

YVYPMMPLDSNDSKSLLLKRIFDNEDDLSLELKEVTDDILKKCHGLPLAIVNIASLLATKPISKMEWERVRGSLGSALEQDHELELVKKILFLSYCDLPHYLKICFLDLSIFPEDHVIGRSCLIRRWIAEGFIAQQQGQRLEDTAENYFSELMNRNMIEPVGTDYSGRPRACRVHDIMLDLIISLSVKENFVTIMADHKLTPSTNKIRRLSLQGNYADQSLRLGTNSLSQVRSFSIFGDVRKIPSLLDFQVLRVLDIQNCSSLEDRDIENIGSLIHLRYLSLYHSNIGNIPTQIGKLKHLQTLDLRATRIKKLPATIAQLHQLVRLCVPNGVQLPNGVGNMAALEELSMLDASKNSPEVVQELGYLTKLKVLGIKWCADSAINDEGNFKKSLISSFCNLGERNLHSLKI

HMMPanther: PTHR11017
20-428 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YVYPMMPLDSNDSKSLLLKRIFDNEDDLSLELKEVTDDILKKCHGLPLAIVNIASLLATKPISKMEWERVRGSLGSALEQDHELELVKKILFLSYCDLPHYLKICFLDLSIFPEDHVIGRSCLIRRWIAEGFIAQQQGQRLEDTAENYFSELMNRNMIEPVGTDYSGRPRACRVHDIMLDLIISLSVKENFVTIMADHKLTPSTNKIRRLSLQGNYADQSLRLGTNSLSQVRSFSIFGDVRKIPSLLDFQVLRVLDIQNCSSLEDRDIENIGSLIHLRYLSLYHSNIGNIPTQIGKLKHLQTLDLRATRIKKLPATIAQLHQLVRLCVPNGVQLPNGVGNMAALEELSMLDASKNSPEVVQELGYLTKLKVLGIKWCADSAINDEGNFKKSLISSFCNLGERNLHSLKI

superfamily: SSF52058
176-605 SSF52058,LRR

MIEPVGTDYSGRPRACRVHDIMLDLIISLSVKENFVTIMADHKLTPSTNKIRRLSLQGNYADQSLRLGTNSLSQVRSFSIFGDVRKIPSLLDFQVLRVLDIQNCSSLEDRDIENIGSLIHLRYLSLYHSNIGNIPTQIGKLKHLQTLDLRATRIKKLPATIAQLHQLVRLCVPNGVQLPNGVGNMAALEELSMLDASKNSPEVVQELGYLTKLKVLGIKWCADSAINDEGNFKKSLISSFCNLGERNLHSLKIETTERCSMDFLFDSLCPDPCCMQKFSNSPIFSRLPKWISYLSVLTNLVIFIEEVGGGDVDVLKDLPALRCLQIFTTEYLQESLIIRAGGFKCLEDFHFRPSMYLKRKKGMMSLIFEAGAMPRLNRLWFRFVVHDTLSAYGAGFDFGISLLSSLKCLWVSINCRGATVWEVEVAKATI

Gene3D: G3DSA:3.80.10.10
227-431 G3DSA:3.80.10.10

RRLSLQGNYADQSLRLGTNSLSQVRSFSIFGDVRKIPSLLDFQVLRVLDIQNCSSLEDRDIENIGSLIHLRYLSLYHSNIGNIPTQIGKLKHLQTLDLRATRIKKLPATIAQLHQLVRLCVPNGVQLPNGVGNMAALEELSMLDASKNSPEVVQELGYLTKLKVLGIKWCADSAINDEGNFKKSLISSFCNLGERNLHSLKIETT


List of References

Andrew H Paterson, John E Bowers, Rémy Bruggmann, Inna Dubchak, Jane Grimwood, Heidrun Gundlach, Georg Haberer, Uffe Hellsten, Therese Mitros, Alexander Poliakov, Jeremy Schmutz, Manuel Spannagl, Haibao Tang, Xiyin Wang, Thomas Wicker, Arvind K Bharti, Jarrod Chapman, F Alex Feltus, Udo Gowik, Igor V Grigoriev, Eric Lyons, Christopher A Maher, Mihaela Martis, Apurva Narechania, Robert P Otillar, Bryan W Penning, Asaf A Salamov, Yu Wang, Lifang Zhang, Nicholas C Carpita, Michael Freeling, Alan R Gingle, C Thomas Hash, Beat Keller, Patricia Klein, Stephen Kresovich, Maureen C McCann, Ray Ming, Daniel G Peterson, Mehboob-ur-Rahman, Doreen Ware, Peter Westhoff, Klaus F X Mayer, Joachim Messing, Daniel S Rokhsar
The Sorghum bicolor genome and the diversification of grasses.
Nature: 2009, 457(7229);551-6
PubMed:19189423 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox