PRGDB00063777 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 242052490 (XM_002455346)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA.

DNA Sequence

ATGGCGGAAGGAGTTCTTGCCTCGAGCATCGTCCATGGGGTGCTGGCTAAGATCGGCTCCTCGATTTGGGCCGAGCTCGCGCTCCTGAGGAGCTTCAGGGCGGACCTGAGGGCCATGGAGCGCGACTTCACCACCGTCCGGGAAGTCCTCTCTGACGCCGAGGCGCGCGGTGATGGAGGCGTCCGCGACTGGCTGCGCAGGCTCAGGGACGTCGCCCACGACATCGATGACCTCCTCGATGAGTGCCGCACAGATCTCTGCGTCTCCGAGCGGCGGGAGAGCACTGCGTGCGGGTGCGGCCCCGTCACCAACCCCTGCTCCCTCCGCTCGTTCGCCATGGCCCGCAGGCTGAAGTCATTGAGGCGCAGGCTGGAATCCATCGCCGCTGGAAGAGACAGACTGCGCCTGAACCCCGGCATCCAGCCGCCAGGACACCCATCCGCTCCTCCCCGGCGCGAGACGATCTCCAAGGTCGACGAGTCCAAGACGGTTGGGCGGGCCGGGGACAGGGAGAAGCTCATGCGGCTGGTCCTCGATGCCGCCAGCGACGAGGACGTGTCCGTGATCCCCATCGTCGGCTTTGGCGGACTCGGCAAGACGACGCTCGCGCAGTTGGTGTTCAACGACCGTCGCGCCAACGATGAGGTGTTCGACCCCCGGATCTGGGTCTCCATGTCCGGCGACTCCAGCCTCCGGACGCTGGTCCAGCCGATCGTGAGCGCGACCAAGGAGAAGTGCGACCTTGACAACCTCGACGCCGTCTCGAGCTTCCTGTCGCGGACGTTCACGGGGATGAAGTATCTGCTCGTTCTCGACGACGTGTGGAGCGAGAATCAGGAGGAGTGGGAGAGGCTGCGGCTACTCCTCAAGGACGGCAAGCGCGGCAGCAAGATCATAGTGACTACACGGAGCCGGAAAGTTGCCATGATGGTTCGCACGGTGGCGCCGTTCGTGCTAGAGGGTCTCTCGGACGACGACTGCTGGGAGGTATTCAGGTACAAGGCATTCGAGGAAGGGGAGGAGAATCTGCACCCCAAGCTGGTCAAGGTAGGCAAAGAAATTGTTCACAAATGTGGCGGCGTGCCGTTAGCAGCGAAGGCTCTTGGGAGCATGTTGAGGTTCAACAAAAATGAACACTCATGGGTGGCTGTCAAGGACAGTGAGATATGGCAGATGGAGAAGGAAGAGACGATATTGCCATCTCTGAAACTTAGCTACGACCAGATGGCACCTAGTGTGAAGCAGTGCTTCGCTTATTGTTCGGTGTTTCCTAGGAGCCATGAAATTGACAGGGATAAGCTTCTTCAGCAATGGGTTGCTCTTGGTTTCATTGAACCTACAAAGTATCGCAGCGAATCACTTTTCGATAGAGCAGATGACTGCTTTGAGCACTTGCTGTGGATGTCATTCCTTCAGGAAGTGGAGGAGCATGATTTATCAAAGAAGGAATTAGAAGAAGACGGCAATGTCAAGTATATGATTCATGAATTGGTGCATGACCTTGCACAATCTGTTGCAAGGGATGAAGTTCAGACAATCACTTCTAACCAGGTTAATGGTCACACTGAAGGATGCTGTTACGTATCGCTGGCTGATGACATGGGAGCGCCTGAAGTTATTCAGAGCATGTTTCACAGAGTTCGTGCCTTCCATTCATGGGGATATAACCTTGACATCAAGCTGGTTCTTCAGTCCAGGTGTTTGCGCGTACTGGATTTGGGAGGCAGCCCTATTACGGAGCTTCCCCAAATGGTTGGCAAACTGAAACACCTAAGCCTCCAAAATTTGCAATTTTTTAACCTTTCACAGTGTGGTATTCTCCGAGAATTGCCTAGAAATATCGGTAACCTGTCAAATTTGTACCACCTGAATTTATCACAATGCAATGATCTCAAGTCAGTCCCAGATTCAATACGCCGGATAACCCGTTTGCATACTTTGAATATGTCTCATTGCAGTAGTCTATCAGAAATACCAGTATCTATTGGTGGCCTTAAAGAGCTTCAGTTTCTTATTTTGTTGCATCATTCAAGCAGTTTATCACTTCCTATATCAACCGGCCATCTACCAAACTTGCAGACGTTGGATCTCTCCTGGAATATTGGTCTGGAGGAATTGCCTGAATCAATCGGCAGTCTTCATAATTTGAAGATCCTGATCTTGTTCCAGTGCTGGAGTCTTTCCAGGTTGCCTGACTCTATATCCAACCTTGTGATGTTGGAAAGTTTGAACCTTGTTGGATGTGAACAGCTGACAAAGCTACCTGATGGCATAATAAGCATCAGCAATCTAAAGCACCTGAGAAATGACCAATGCTCAGCTTTGGAGAGACTGCCTCATGGATTTGGGCAATGGACAAAACTTGAAACATTGTCCCTACTTACAGTAGGTGACAAAAATAGCAATATTGCTGAGCTAGAGCACCTTAATGTTTTAACTGGTCAGCTGAGGATTGAATGCCAGTCACCCATGAAGGTTCCGTCAACTGATGCCATGAGAGCGAACTTAAGGAAGAAGAAAAAGTTAAGCAGCTTAACCTTGTCATGGACCAGGTCTTGTTCCATTGAAGAACTGATAAGTGCTGAAACATTTCTTGAAGTCCTCATGCCACCTGAAAACCTCGAAGTTTTTGAGATAGACGGTTATCTGGGCACTAAATTTTCCAGTTGGATGATGAACAGCATGGAACTGTTGCTTCCGAATCTTGTTTCCCTCAGTTTCAGCAACATCCATCATTGTAGTTGCCTTCCGCACCTTGGCCATTTTCCGCATCTACAGTCTCTTCAGCTCCGCCACATTACCGGTGTTTATAGCATGGACTCTGAAATGCCTGTAAAAATAAACAAAGGTACTCTATACCGATCGTTGAAGGAACTCCACTTTGAAGACATGCCCAACCTGGAGATTTGGCTAACATCACCGGTAACCGATCACAAGGACAAAGAACCAGACCTATTCAAGTTTCCTGTTCTTAAAACTGTCACTGTAACTGAATGCCCAATGTTGACACCACAGCCGTGCCTGCCTGATGCCATAGCAGATTTGTCGGTGTCCGGCAGCAGCTCGATGTTATCAGTTGGTAGAATCGCCGTACCACCATCATCGCTTCTGAGGAGATTATGGATTAAAAACTGCCATGTTTCTTCTAACGAGTGGAGATTGTTGCGGCACAGACCAAAGCTCGAGGACCTAGTGATCGAATACTGTGAGAGGCTGCATGTTCTGCCCGAGGCCATCCGGTCCCTCACTAACCTGCGGAGACTGAAGATTCTAAATTGCAGGGAACTGAAAGCCCTTCCGGAATGGCTCGGTGAACTTGCGACGCTTGAATCTCTGGAGATACGCTGCTGTCCCAAGCTGGTTTCACTGCCCAAAGGTTTGCAAGGCTTGACTGCACTGGAGCAGCTAACCGTCACTGGGTGCAGCACTGATCTGAACGAGAGGTGCACAAAAGCTACAGGCAGAGATTGGTTCAAGATATGCCATGTTCCAAGTATCATTGTCTCATAA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein SORBIDRAFT_03g010030 [Sorghum bicolor].

MAEGVLASSIVHGVLAKIGSSIWAELALLRSFRADLRAMERDFTTVREVLSDAEARGDGGVRDWLRRLRDVAHDIDDLLDECRTDLCVSERRESTACGCGPVTNPCSLRSFAMARRLKSLRRRLESIAAGRDRLRLNPGIQPPGHPSAPPRRETISKVDESKTVGRAGDREKLMRLVLDAASDEDVSVIPIVGFGGLGKTTLAQLVFNDRRANDEVFDPRIWVSMSGDSSLRTLVQPIVSATKEKCDLDNLDAVSSFLSRTFTGMKYLLVLDDVWSENQEEWERLRLLLKDGKRGSKIIVTTRSRKVAMMVRTVAPFVLEGLSDDDCWEVFRYKAFEEGEENLHPKLVKVGKEIVHKCGGVPLAAKALGSMLRFNKNEHSWVAVKDSEIWQMEKEETILPSLKLSYDQMAPSVKQCFAYCSVFPRSHEIDRDKLLQQWVALGFIEPTKYRSESLFDRADDCFEHLLWMSFLQEVEEHDLSKKELEEDGNVKYMIHELVHDLAQSVARDEVQTITSNQVNGHTEGCCYVSLADDMGAPEVIQSMFHRVRAFHSWGYNLDIKLVLQSRCLRVLDLGGSPITELPQMVGKLKHLSLQNLQFFNLSQCGILRELPRNIGNLSNLYHLNLSQCNDLKSVPDSIRRITRLHTLNMSHCSSLSEIPVSIGGLKELQFLILLHHSSSLSLPISTGHLPNLQTLDLSWNIGLEELPESIGSLHNLKILILFQCWSLSRLPDSISNLVMLESLNLVGCEQLTKLPDGIISISNLKHLRNDQCSALERLPHGFGQWTKLETLSLLTVGDKNSNIAELEHLNVLTGQLRIECQSPMKVPSTDAMRANLRKKKKLSSLTLSWTRSCSIEELISAETFLEVLMPPENLEVFEIDGYLGTKFSSWMMNSMELLLPNLVSLSFSNIHHCSCLPHLGHFPHLQSLQLRHITGVYSMDSEMPVKINKGTLYRSLKELHFEDMPNLEIWLTSPVTDHKDKEPDLFKFPVLKTVTVTECPMLTPQPCLPDAIADLSVSGSSSMLSVGRIAVPPSSLLRRLWIKNCHVSSNEWRLLRHRPKLEDLVIEYCERLHVLPEAIRSLTNLRRLKILNCRELKALPEWLGELATLESLEIRCCPKLVSLPKGLQGLTALEQLTVTGCSTDLNERCTKATGRDWFKICHVPSIIVS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-1167 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEGVLASSIVHGVLAKIGSSIWAELALLRSFRADLRAMERDFTTVREVLSDAEARGDGGVRDWLRRLRDVAHDIDDLLDECRTDLCVSERRESTACGCGPVTNPCSLRSFAMARRLKSLRRRLESIAAGRDRLRLNPGIQPPGHPSAPPRRETISKVDESKTVGRAGDREKLMRLVLDAASDEDVSVIPIVGFGGLGKTTLAQLVFNDRRANDEVFDPRIWVSMSGDSSLRTLVQPIVSATKEKCDLDNLDAVSSFLSRTFTGMKYLLVLDDVWSENQEEWERLRLLLKDGKRGSKIIVTTRSRKVAMMVRTVAPFVLEGLSDDDCWEVFRYKAFEEGEENLHPKLVKVGKEIVHKCGGVPLAAKALGSMLRFNKNEHSWVAVKDSEIWQMEKEETILPSLKLSYDQMAPSVKQCFAYCSVFPRSHEIDRDKLLQQWVALGFIEPTKYRSESLFDRADDCFEHLLWMSFLQEVEEHDLSKKELEEDGNVKYMIHELVHDLAQSVARDEVQTITSNQVNGHTEGCCYVSLADDMGAPEVIQSMFHRVRAFHSWGYNLDIKLVLQSRCLRVLDLGGSPITELPQMVGKLKHLSLQNLQFFNLSQCGILRELPRNIGNLSNLYHLNLSQCNDLKSVPDSIRRITRLHTLNMSHCSSLSEIPVSIGGLKELQFLILLHHSSSLSLPISTGHLPNLQTLDLSWNIGLEELPESIGSLHNLKILILFQCWSLSRLPDSISNLVMLESLNLVGCEQLTKLPDGIISISNLKHLRNDQCSALERLPHGFGQWTKLETLSLLTVGDKNSNIAELEHLNVLTGQLRIECQSPMKVPSTDAMRANLRKKKKLSSLTLSWTRSCSIEELISAETFLEVLMPPENLEVFEIDGYLGTKFSSWMMNSMELLLPNLVSLSFSNIHHCSCLPHLGHFPHLQSLQLRHITGVYSMDSEMPVKINKGTLYRSLKELHFEDMPNLEIWLTSPVTDHKDKEPDLFKFPVLKTVTVTECPMLTPQPCLPDAIADLSVSGSSSMLSVGRIAVPPSSLLRRLWIKNCHVSSNEWRLLRHRPKLEDLVIEYCERLHVLPEAIRSLTNLRRLKILNCRELKALPEWLGELATLESLEIRCCPKLVSLPKGLQGLTALEQLTVTGCSTDLNERCTKATGRDWFKICHVPSII

HMMPanther: PTHR23155:SF123
2-1167 PTHR23155:SF123,NBS-LRR DISEASE RESISTANCE PROTEIN-LIKE (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01

AEGVLASSIVHGVLAKIGSSIWAELALLRSFRADLRAMERDFTTVREVLSDAEARGDGGVRDWLRRLRDVAHDIDDLLDECRTDLCVSERRESTACGCGPVTNPCSLRSFAMARRLKSLRRRLESIAAGRDRLRLNPGIQPPGHPSAPPRRETISKVDESKTVGRAGDREKLMRLVLDAASDEDVSVIPIVGFGGLGKTTLAQLVFNDRRANDEVFDPRIWVSMSGDSSLRTLVQPIVSATKEKCDLDNLDAVSSFLSRTFTGMKYLLVLDDVWSENQEEWERLRLLLKDGKRGSKIIVTTRSRKVAMMVRTVAPFVLEGLSDDDCWEVFRYKAFEEGEENLHPKLVKVGKEIVHKCGGVPLAAKALGSMLRFNKNEHSWVAVKDSEIWQMEKEETILPSLKLSYDQMAPSVKQCFAYCSVFPRSHEIDRDKLLQQWVALGFIEPTKYRSESLFDRADDCFEHLLWMSFLQEVEEHDLSKKELEEDGNVKYMIHELVHDLAQSVARDEVQTITSNQVNGHTEGCCYVSLADDMGAPEVIQSMFHRVRAFHSWGYNLDIKLVLQSRCLRVLDLGGSPITELPQMVGKLKHLSLQNLQFFNLSQCGILRELPRNIGNLSNLYHLNLSQCNDLKSVPDSIRRITRLHTLNMSHCSSLSEIPVSIGGLKELQFLILLHHSSSLSLPISTGHLPNLQTLDLSWNIGLEELPESIGSLHNLKILILFQCWSLSRLPDSISNLVMLESLNLVGCEQLTKLPDGIISISNLKHLRNDQCSALERLPHGFGQWTKLETLSLLTVGDKNSNIAELEHLNVLTGQLRIECQSPMKVPSTDAMRANLRKKKKLSSLTLSWTRSCSIEELISAETFLEVLMPPENLEVFEIDGYLGTKFSSWMMNSMELLLPNLVSLSFSNIHHCSCLPHLGHFPHLQSLQLRHITGVYSMDSEMPVKINKGTLYRSLKELHFEDMPNLEIWLTSPVTDHKDKEPDLFKFPVLKTVTVTECPMLTPQPCLPDAIADLSVSGSSSMLSVGRIAVPPSSLLRRLWIKNCHVSSNEWRLLRHRPKLEDLVIEYCERLHVLPEAIRSLTNLRRLKILNCRELKALPEWLGELATLESLEIRCCPKLVSLPKGLQGLTALEQLTVTGCSTDLNERCTKATGRDWFKICHVPSII

superfamily: SSF52540
145-395 SSF52540

HPSAPPRRETISKVDESKTVGRAGDREKLMRLVLDAASDEDVSVIPIVGFGGLGKTTLAQLVFNDRRANDEVFDPRIWVSMSGDSSLRTLVQPIVSATKEKCDLDNLDAVSSFLSRTFTGMKYLLVLDDVWSENQEEWERLRLLLKDGKRGSKIIVTTRSRKVAMMVRTVAPFVLEGLSDDDCWEVFRYKAFEEGEENLHPKLVKVGKEIVHKCGGVPLAAKALGSMLRFNKNEHSWVAVKDSEIWQMEKE

Gene3D: G3DSA:3.40.50.300
181-305 G3DSA:3.40.50.300

ASDEDVSVIPIVGFGGLGKTTLAQLVFNDRRANDEVFDPRIWVSMSGDSSLRTLVQPIVSATKEKCDLDNLDAVSSFLSRTFTGMKYLLVLDDVWSENQEEWERLRLLLKDGKRGSKIIVTTRSR

HMMPfam: PF00931
IPR002182
182-447 NB-ARC,NBS
NB-ARC

SDEDVSVIPIVGFGGLGKTTLAQLVFNDRRANDEVFDPRIWVSMSGDSSLRTLVQPIVSATKEKCDLDNLDAVSSFLSRTFTGMKYLLVLDDVWSENQEEWERLRLLLKDGKRGSKIIVTTRSRKVAMMVRTVAPFVLEGLSDDDCWEVFRYKAFEEGEENLHPKLVKVGKEIVHKCGGVPLAAKALGSMLRFNKNEHSWVAVKDSEIWQMEKEETILPSLKLSYDQMAPSVKQCFAYCSVFPRSHEIDRDKLLQQWVALGFIEPT

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VIPIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
261-275 DISEASERSIST
Disease resistance protein

TFTGMKYLLVLDDVW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CGGVPLAAKALGSML

superfamily: SSF52047
471-793 SSF52047,LRR

LQEVEEHDLSKKELEEDGNVKYMIHELVHDLAQSVARDEVQTITSNQVNGHTEGCCYVSLADDMGAPEVIQSMFHRVRAFHSWGYNLDIKLVLQSRCLRVLDLGGSPITELPQMVGKLKHLSLQNLQFFNLSQCGILRELPRNIGNLSNLYHLNLSQCNDLKSVPDSIRRITRLHTLNMSHCSSLSEIPVSIGGLKELQFLILLHHSSSLSLPISTGHLPNLQTLDLSWNIGLEELPESIGSLHNLKILILFQCWSLSRLPDSISNLVMLESLNLVGCEQLTKLPDGIISISNLKHLRNDQCSALERLPHGFGQWTKLETLSL

Gene3D: G3DSA:3.80.10.10
566-690 G3DSA:3.80.10.10

RCLRVLDLGGSPITELPQMVGKLKHLSLQNLQFFNLSQCGILRELPRNIGNLSNLYHLNLSQCNDLKSVPDSIRRITRLHTLNMSHCSSLSEIPVSIGGLKELQFLILLHHSSSLSLPISTGHLP

FPrintScan: PR00364
IPR000767
615-631 DISEASERSIST
Disease resistance protein

GNLSNLYHLNLSQCNDL

HMMPfam: PF00560
IPR001611
643-665 LRR_1
Leucine-rich repeat

RLHTLNMSHCSSLSEIPVSIGGL

Gene3D: G3DSA:3.80.10.10
691-863 G3DSA:3.80.10.10

NLQTLDLSWNIGLEELPESIGSLHNLKILILFQCWSLSRLPDSISNLVMLESLNLVGCEQLTKLPDGIISISNLKHLRNDQCSALERLPHGFGQWTKLETLSLLTVGDKNSNIAELEHLNVLTGQLRIECQSPMKVPSTDAMRANLRKKKKLSSLTLSWTRSCSIEELISAET

HMMPfam: PF00560
IPR001611
691-713 LRR_1
Leucine-rich repeat

NLQTLDLSWNIGLEELPESIGSL

superfamily: SSF52047
863-1142 SSF52047,LRR

TFLEVLMPPENLEVFEIDGYLGTKFSSWMMNSMELLLPNLVSLSFSNIHHCSCLPHLGHFPHLQSLQLRHITGVYSMDSEMPVKINKGTLYRSLKELHFEDMPNLEIWLTSPVTDHKDKEPDLFKFPVLKTVTVTECPMLTPQPCLPDAIADLSVSGSSSMLSVGRIAVPPSSLLRRLWIKNCHVSSNEWRLLRHRPKLEDLVIEYCERLHVLPEAIRSLTNLRRLKILNCRELKALPEWLGELATLESLEIRCCPKLVSLPKGLQGLTALEQLTVTGCS

Gene3D: G3DSA:3.80.10.10
898-1142 G3DSA:3.80.10.10

LLPNLVSLSFSNIHHCSCLPHLGHFPHLQSLQLRHITGVYSMDSEMPVKINKGTLYRSLKELHFEDMPNLEIWLTSPVTDHKDKEPDLFKFPVLKTVTVTECPMLTPQPCLPDAIADLSVSGSSSMLSVGRIAVPPSSLLRRLWIKNCHVSSNEWRLLRHRPKLEDLVIEYCERLHVLPEAIRSLTNLRRLKILNCRELKALPEWLGELATLESLEIRCCPKLVSLPKGLQGLTALEQLTVTGCS


List of References

Andrew H Paterson, John E Bowers, Rémy Bruggmann, Inna Dubchak, Jane Grimwood, Heidrun Gundlach, Georg Haberer, Uffe Hellsten, Therese Mitros, Alexander Poliakov, Jeremy Schmutz, Manuel Spannagl, Haibao Tang, Xiyin Wang, Thomas Wicker, Arvind K Bharti, Jarrod Chapman, F Alex Feltus, Udo Gowik, Igor V Grigoriev, Eric Lyons, Christopher A Maher, Mihaela Martis, Apurva Narechania, Robert P Otillar, Bryan W Penning, Asaf A Salamov, Yu Wang, Lifang Zhang, Nicholas C Carpita, Michael Freeling, Alan R Gingle, C Thomas Hash, Beat Keller, Patricia Klein, Stephen Kresovich, Maureen C McCann, Ray Ming, Daniel G Peterson, Mehboob-ur-Rahman, Doreen Ware, Peter Westhoff, Klaus F X Mayer, Joachim Messing, Daniel S Rokhsar
The Sorghum bicolor genome and the diversification of grasses.
Nature: 2009, 457(7229);551-6
PubMed:19189423 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox