PRGDB00063782 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 242093703 (XM_002437297)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA.

DNA Sequence

CAGCCTATTTCTTTCCCGTCATATCTGACAATGGTTGCGGTCGGGGAGTTGCTAGCTAAGCTCGCCTTCAACGCCACCTGGAACGAGATTGCTTTGCAGCTGAATTTCAGTAAAGATTTGAAGAGCATCAAGGACAACCTTTCCTTTGTCCAATCTTTCCTTGAGGACGCGGAGAGACTGTCGTCAAGGTTGGAGAGCGTCCGTCACACGCTTAAGAAGCTCAAGGCTGCGGCTTATGACTTGGAGGATATGCTGCTACTCTTCGAGTGCTGGACCACCCCTCACAAGGGTGAAGGCCTTGCGCTTAGCGCCAAGGCTAAAAAGGGGTTAGTTTTATGCTTTGAAAGGTTGAAGATGCCTCATAAAATGAGAAAAATGAGGGAAACCATAGAGGAGATAGTAGATCTCCAGAATAAATTCAACTTCATCAAACACACTGGCAACAATGATGAAGAAGTAATCAGGAAACGGGAGACATTCTCAGATGCTGATGAAGTCCCCGTTGGGAGGATGGAAGAAAAAGAAAGATTAATCAGAGTAGGTAAAACTACTCTTGCCCAGATGGTGTTCAACGATGATAGAACAAGACAATTATTTGAAATCCAAGCGTGGGTCTATGTCTCTCTAAAATTTGATATCAATACCATCGGTCAATCTATCATCTCCCAACTGGATAAATCAAGCAGCCCTTCTGGTATCCCCTTACAAGCTACACGTGGCCGACTGAAAACTATTGTAACAGGGCAACGGTTTCTTATTATTCTCGATGACATATGGGAAGAAGATCCACATGAGTTGGAAAAACTATGGACATTGCTGCGGGGTGCTAAAGCAGGCAGCAAGATCATTGCAACCACACGCAGTGTAAAAGTTGCTAAGCTAATGAATGGGAGTTTGACAATAGAATTAAGTGCTTTACCAGACAATTACTGCTGGGAGTTGTTCCGAAAAAAGGCATTTCCATATGGAAAGGTGGATGTTGATAAGGAAAGTATAGGAAGACAGATAGTCATGAAATGCAGAGGAATGCCACTAGCAGCAATTTCTCTCGGATACCTTTGCCGGACAACTAATGAATGGAAAGCTATCCTGGATAGTGATATCTGGGCAGAAAATGGAGATGATGGACGGTTACTCAAAGATACGAAAGTGCTACCATCACTGAAGCTTAGTTATCAATGCATGTCTTATCATCTCAAGCTCTGTTTTGCATATTGCGCTATTTTCCCCAAAGGCTGGTATATAGAGAAGAGTAGCTTGATTCAGCAGTGGATTGCCCTTGGATTTCTTCAGCTCCATGGCGAATCGTTCACTGCACAACAAGCTGGAGAAAGATACTTTGAGGATCTTCGTGAAATGTCTTTTCTTCAGGATGTAGCTGGAATGTCTCCAACCAAGCCGTTTGCAAGATATAACAAACCTCGAGGTGTATTATTCCAGATGCATGATTTGGTTCGTGAGCTTGCAAGATTAGTTGCGGGTGACGAAGTTGTTGCCTTTGACACTAGGAAGCAAAATCCTCCTACAAATATAGACAACTGTCGATACATGTTGCTCTCAAACTTATGTAACTCATCCTCATCTTATTGGTCTATTCCTAGCACATCAAGAGCTCTTCATTTTAAGGAGTGCAGCATTGTTCAGACTACTTTAAAGTCTCTAATGGGAGCTGAATTCCTACGTGTGCTGGATTTTAGTGCATGTGCTATTTCTGATCTACCTGCTTCTGTCGGCAATTTGAGACTCTTGAAGTTCTTAAATATATCTGGAATGCAAACTGGTCTGCTGCCTAAGCCCCTGAGCTCATTGCATGGTTTACAAGCATTGAACCTTTCTGAAAATACTTGCCTTATTGAACTTCCAAGTTACATTTCTGAATTTGTCAACCTACAATATTTGGACCTACATGGCTGCTCAAATCTTGAAGAGCTGCCACAGGGCATTCATAAACTCAAAGAGCTACTACACCTGAACGTATCAAGATGTGGTAGGCTACAATTTCTGCCTGAAGAGTTTGGGGAGCTTCGGAAACTTGCATTCCTCAACCTTTCATATTGTTCCCAGCTTCAAACGCTGCCTTCAAATTTTGGTGGCCTTCAGGATCTTTCATATCTCAATCTATTGCACTGTTACAAACTTCATGGGCTGCCTGATTCTTTCATCTACCTAGCAAATATGATACATCTAAATATGTCCTTCTGCCGCCAGTTGAAACTGCTGCCTAGTGGGTTATTTAAGTACATGAAGAAACTTCTAGTCTTGAATTTGTCTGGTTGTACCTCTCTTGAAGTTCTTCCTGAATTTTGCAATATTGATGCTGGCTGTCGGATGTTGAAAACTTTGGAGTTACCAGATTGTACTAATCTGGCTGTCCTTCCCAAATCCTGTACCAGTCTTTGTGAGCTCCGGTGTTTAAATCTATCAGGTTGTTCTCGAATTCAGAACTTTCTAAATTTGATTCCGCAGTGGAAATTCGGTAAGTTGGAGTACCTAAATCTCTCCGAGGTCGGTGCAAAAGCTTATTTTGAAGATCCAGGAACCTCTGCGGGAAATGTAGGGAGTTCAGAAGACCCTAATAGAGAACTAGAGTTAGGTATGCTGCAAGAGGATATTGTGACCCAACGTTTGGTTTATCTTAAATACCTGTCAGTTGGAGGGTTCACACTCTTCTCAGAACAAGGCATTGCAAGCTTGGTAGACCTTCTAACCTTGCCCAATTTTGATGTACAGACACAACCCGGTGACAACCAAAGCAATATTAAGCTTCTCCAGCAGATTCTGGATCTCACACATCATGAGTTAAACATCAAATGCCTTGAGAATGTGGTATCACCAGAGGAAGCAAAGCAAGTGGAACTGGGTAGGAATCAACAACTTCATTTCTTGAGTCTTGAATGGTCCTCATCTGATATTGGGTCTTCTATTGGAAAGGATCGTCTAACAAAGGCTACCGAAGTGCTGGAACATTTGAAGCCCCATCAGAATTTACAGCATCTCTCTATAAAAGGCTACAGCGGCACAATATTTCCAGATTGGATTAACAATATAAATGATGCACTCCCGAATCTGGTGAAAATAATATTGTCTGATCTCAAGGGATGTGACCACATTCCTGCATTGGGAAATTTGCCAAATCTACAAGAACTGGAAATCAATGATATGCCCCTGCTTGGCCATGTAAGAATTGTACCATGCAAGAAGCTAAGACGACTTGCATTGGTTAATCTGCGAGAATACACCACTGTACATATATTTTATGATGACAACACTGAGACTCAAGTAAATGAGGTGGTGGAATTAAGTCACGACTGTGATAAGGTAGAGAAACTAACAGGAGACGAGATAAGACTACATGAAGTTGCATCAAGTTGTGACTGTAGTGAGGAAGAGAGGAAAACAGCAGAAAAAACTGACGAGTTAGCTGGTTCTCTTCCTTCAAACAGGCAATCTAAAAGAAAGTGGCATATCATGGCCTGTGAAGGCCAAGACCTAAAGTCTATGGTAGGAGCCCGAGCTCTGCGTGTGAAGGTCAAGGATTTGTTGAAAGGTCCATATTGTGGCAAGTGGAGGGAAACATACATAACACAGGACACTGCAGGTGCCGGAAATGACTCACCTGCTGTAATGAGCAGCAAGCCGGCACTAACTCCAGGTCCATCTAATGAAACAACAGAACAAGCAGCAGTCCCTACGCTTGATTACTTCAAGATAGAAAGCTGTCAGAACCTACGACTGTATCCATATTACATCCCAATGTGTGAAGAGTTGTTCATCAATGATAGCAGTATCGACCTGGATGATATGGAACAGGAGTCATCTGAGTCACCTGCAGTTACCAGTAGCAGGCCGGCACTAACTCCAGGTCCATCTATTGAAACAAGAGAACAAGCGGTCCCTAGGCTTGATTTGTTCAAGTTAGAAAGCAGCCAGAACCTACAACTGTATCCATATTACATCCCAATGTGTGAAGAGTTATTCATCAAGGATAGCAGTCTTGATCTGGATGATATGGAACAGGAGTTATCTGAGTCACCTGCAGTTACCAGTAGCAGGCCGGCACTAACTCCAGGTCCATCTATTGAAACAAGAGAACAAGCAGCAGTCCCTACGCTTGATTACTTCAAGTTAGAAAGCAGCCAGAATCTACAACTGTATCCATATTACAGCCCAATGTCTGAAGAATTATTCATCAAGGATAGCAGTCTCGATCTGGATGATATGGAATCAGAGTCACCTGGAATGCTCGGACAGGAGTTATCTTACGGAATGTATGAAGGGGAGTTTGGTTCCTTAATGCACGGACGAGACCCCACTTCCAGAAGGTACAGATCGGAGTCTATTTCTGGAACCTCACGGAAACTCAAGATAGCAAATTGCAACCAGCTGTCTCTTGGTCGGCTGTTGCTTTTATTAAAATCATCACTACAGGAACTCGAAATTGATAGCATGGAAAGGATCGATGACTCCATGCGCGGACGGTACATGGACAAATGGGAGTCTATCTCTGGAACCCTACGGAAACTCAAGATAACAAATTGCAACCAGCATATTGTTAACCGACTGTTGCTTCTATTCAAATCATCACTACAGGAACTTGAAATTGATGGCATCAAAAGCATTGATGCCTTGCCATCAAATCTGTTCGAAATGACCAGATTGGAAAAAATCACTATATCATCTCTTGAGCTTCAAGAAGCAAAAGGGAGCAACAATATTAGGAAACAACTGTACGTTTCTGGAATTGCATACATCAATACAAGACAT


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein SORBIDRAFT_10g025283 [Sorghum bicolor].

QPISFPSYLTMVAVGELLAKLAFNATWNEIALQLNFSKDLKSIKDNLSFVQSFLEDAERLSSRLESVRHTLKKLKAAAYDLEDMLLLFECWTTPHKGEGLALSAKAKKGLVLCFERLKMPHKMRKMRETIEEIVDLQNKFNFIKHTGNNDEEVIRKRETFSDADEVPVGRMEEKERLIRVGKTTLAQMVFNDDRTRQLFEIQAWVYVSLKFDINTIGQSIISQLDKSSSPSGIPLQATRGRLKTIVTGQRFLIILDDIWEEDPHELEKLWTLLRGAKAGSKIIATTRSVKVAKLMNGSLTIELSALPDNYCWELFRKKAFPYGKVDVDKESIGRQIVMKCRGMPLAAISLGYLCRTTNEWKAILDSDIWAENGDDGRLLKDTKVLPSLKLSYQCMSYHLKLCFAYCAIFPKGWYIEKSSLIQQWIALGFLQLHGESFTAQQAGERYFEDLREMSFLQDVAGMSPTKPFARYNKPRGVLFQMHDLVRELARLVAGDEVVAFDTRKQNPPTNIDNCRYMLLSNLCNSSSSYWSIPSTSRALHFKECSIVQTTLKSLMGAEFLRVLDFSACAISDLPASVGNLRLLKFLNISGMQTGLLPKPLSSLHGLQALNLSENTCLIELPSYISEFVNLQYLDLHGCSNLEELPQGIHKLKELLHLNVSRCGRLQFLPEEFGELRKLAFLNLSYCSQLQTLPSNFGGLQDLSYLNLLHCYKLHGLPDSFIYLANMIHLNMSFCRQLKLLPSGLFKYMKKLLVLNLSGCTSLEVLPEFCNIDAGCRMLKTLELPDCTNLAVLPKSCTSLCELRCLNLSGCSRIQNFLNLIPQWKFGKLEYLNLSEVGAKAYFEDPGTSAGNVGSSEDPNRELELGMLQEDIVTQRLVYLKYLSVGGFTLFSEQGIASLVDLLTLPNFDVQTQPGDNQSNIKLLQQILDLTHHELNIKCLENVVSPEEAKQVELGRNQQLHFLSLEWSSSDIGSSIGKDRLTKATEVLEHLKPHQNLQHLSIKGYSGTIFPDWINNINDALPNLVKIILSDLKGCDHIPALGNLPNLQELEINDMPLLGHVRIVPCKKLRRLALVNLREYTTVHIFYDDNTETQVNEVVELSHDCDKVEKLTGDEIRLHEVASSCDCSEEERKTAEKTDELAGSLPSNRQSKRKWHIMACEGQDLKSMVGARALRVKVKDLLKGPYCGKWRETYITQDTAGAGNDSPAVMSSKPALTPGPSNETTEQAAVPTLDYFKIESCQNLRLYPYYIPMCEELFINDSSIDLDDMEQESSESPAVTSSRPALTPGPSIETREQAVPRLDLFKLESSQNLQLYPYYIPMCEELFIKDSSLDLDDMEQELSESPAVTSSRPALTPGPSIETREQAAVPTLDYFKLESSQNLQLYPYYSPMSEELFIKDSSLDLDDMESESPGMLGQELSYGMYEGEFGSLMHGRDPTSRRYRSESISGTSRKLKIANCNQLSLGRLLLLLKSSLQELEIDSMERIDDSMRGRYMDKWESISGTLRKLKITNCNQHIVNRLLLLFKSSLQELEIDGIKSIDALPSNLFEMTRLEKITISSLELQEAKGSNNIRKQLYVSGIAYINTRH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
8-1558 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YLTMVAVGELLAKLAFNATWNEIALQLNFSKDLKSIKDNLSFVQSFLEDAERLSSRLESVRHTLKKLKAAAYDLEDMLLLFECWTTPHKGEGLALSAKAKKGLVLCFERLKMPHKMRKMRETIEEIVDLQNKFNFIKHTGNNDEEVIRKRETFSDADEVPVGRMEEKERLIRVGKTTLAQMVFNDDRTRQLFEIQAWVYVSLKFDINTIGQSIISQLDKSSSPSGIPLQATRGRLKTIVTGQRFLIILDDIWEEDPHELEKLWTLLRGAKAGSKIIATTRSVKVAKLMNGSLTIELSALPDNYCWELFRKKAFPYGKVDVDKESIGRQIVMKCRGMPLAAISLGYLCRTTNEWKAILDSDIWAENGDDGRLLKDTKVLPSLKLSYQCMSYHLKLCFAYCAIFPKGWYIEKSSLIQQWIALGFLQLHGESFTAQQAGERYFEDLREMSFLQDVAGMSPTKPFARYNKPRGVLFQMHDLVRELARLVAGDEVVAFDTRKQNPPTNIDNCRYMLLSNLCNSSSSYWSIPSTSRALHFKECSIVQTTLKSLMGAEFLRVLDFSACAISDLPASVGNLRLLKFLNISGMQTGLLPKPLSSLHGLQALNLSENTCLIELPSYISEFVNLQYLDLHGCSNLEELPQGIHKLKELLHLNVSRCGRLQFLPEEFGELRKLAFLNLSYCSQLQTLPSNFGGLQDLSYLNLLHCYKLHGLPDSFIYLANMIHLNMSFCRQLKLLPSGLFKYMKKLLVLNLSGCTSLEVLPEFCNIDAGCRMLKTLELPDCTNLAVLPKSCTSLCELRCLNLSGCSRIQNFLNLIPQWKFGKLEYLNLSEVGAKAYFEDPGTSAGNVGSSEDPNRELELGMLQEDIVTQRLVYLKYLSVGGFTLFSEQGIASLVDLLTLPNFDVQTQPGDNQSNIKLLQQILDLTHHELNIKCLENVVSPEEAKQVELGRNQQLHFLSLEWSSSDIGSSIGKDRLTKATEVLEHLKPHQNLQHLSIKGYSGTIFPDWINNINDALPNLVKIILSDLKGCDHIPALGNLPNLQELEINDMPLLGHVRIVPCKKLRRLALVNLREYTTVHIFYDDNTETQVNEVVELSHDCDKVEKLTGDEIRLHEVASSCDCSEEERKTAEKTDELAGSLPSNRQSKRKWHIMACEGQDLKSMVGARALRVKVKDLLKGPYCGKWRETYITQDTAGAGNDSPAVMSSKPALTPGPSNETTEQAAVPTLDYFKIESCQNLRLYPYYIPMCEELFINDSSIDLDDMEQESSESPAVTSSRPALTPGPSIETREQAVPRLDLFKLESSQNLQLYPYYIPMCEELFIKDSSLDLDDMEQELSESPAVTSSRPALTPGPSIETREQAAVPTLDYFKLESSQNLQLYPYYSPMSEELFIKDSSLDLDDMESESPGMLGQELSYGMYEGEFGSLMHGRDPTSRRYRSESISGTSRKLKIANCNQLSLGRLLLLLKSSLQELEIDSMERIDDSMRGRYMDKWESISGTLRKLKITNCNQHIVNRLLLLFKSSLQELEIDGIKSIDALPSNLFEMTRLEKITI

HMMPanther: PTHR23155:SF47
8-1558 PTHR23155:SF47,OS06G0644300 PROTEIN

YLTMVAVGELLAKLAFNATWNEIALQLNFSKDLKSIKDNLSFVQSFLEDAERLSSRLESVRHTLKKLKAAAYDLEDMLLLFECWTTPHKGEGLALSAKAKKGLVLCFERLKMPHKMRKMRETIEEIVDLQNKFNFIKHTGNNDEEVIRKRETFSDADEVPVGRMEEKERLIRVGKTTLAQMVFNDDRTRQLFEIQAWVYVSLKFDINTIGQSIISQLDKSSSPSGIPLQATRGRLKTIVTGQRFLIILDDIWEEDPHELEKLWTLLRGAKAGSKIIATTRSVKVAKLMNGSLTIELSALPDNYCWELFRKKAFPYGKVDVDKESIGRQIVMKCRGMPLAAISLGYLCRTTNEWKAILDSDIWAENGDDGRLLKDTKVLPSLKLSYQCMSYHLKLCFAYCAIFPKGWYIEKSSLIQQWIALGFLQLHGESFTAQQAGERYFEDLREMSFLQDVAGMSPTKPFARYNKPRGVLFQMHDLVRELARLVAGDEVVAFDTRKQNPPTNIDNCRYMLLSNLCNSSSSYWSIPSTSRALHFKECSIVQTTLKSLMGAEFLRVLDFSACAISDLPASVGNLRLLKFLNISGMQTGLLPKPLSSLHGLQALNLSENTCLIELPSYISEFVNLQYLDLHGCSNLEELPQGIHKLKELLHLNVSRCGRLQFLPEEFGELRKLAFLNLSYCSQLQTLPSNFGGLQDLSYLNLLHCYKLHGLPDSFIYLANMIHLNMSFCRQLKLLPSGLFKYMKKLLVLNLSGCTSLEVLPEFCNIDAGCRMLKTLELPDCTNLAVLPKSCTSLCELRCLNLSGCSRIQNFLNLIPQWKFGKLEYLNLSEVGAKAYFEDPGTSAGNVGSSEDPNRELELGMLQEDIVTQRLVYLKYLSVGGFTLFSEQGIASLVDLLTLPNFDVQTQPGDNQSNIKLLQQILDLTHHELNIKCLENVVSPEEAKQVELGRNQQLHFLSLEWSSSDIGSSIGKDRLTKATEVLEHLKPHQNLQHLSIKGYSGTIFPDWINNINDALPNLVKIILSDLKGCDHIPALGNLPNLQELEINDMPLLGHVRIVPCKKLRRLALVNLREYTTVHIFYDDNTETQVNEVVELSHDCDKVEKLTGDEIRLHEVASSCDCSEEERKTAEKTDELAGSLPSNRQSKRKWHIMACEGQDLKSMVGARALRVKVKDLLKGPYCGKWRETYITQDTAGAGNDSPAVMSSKPALTPGPSNETTEQAAVPTLDYFKIESCQNLRLYPYYIPMCEELFINDSSIDLDDMEQESSESPAVTSSRPALTPGPSIETREQAVPRLDLFKLESSQNLQLYPYYIPMCEELFIKDSSLDLDDMEQELSESPAVTSSRPALTPGPSIETREQAAVPTLDYFKLESSQNLQLYPYYSPMSEELFIKDSSLDLDDMESESPGMLGQELSYGMYEGEFGSLMHGRDPTSRRYRSESISGTSRKLKIANCNQLSLGRLLLLLKSSLQELEIDSMERIDDSMRGRYMDKWESISGTLRKLKITNCNQHIVNRLLLLFKSSLQELEIDGIKSIDALPSNLFEMTRLEKITI

HMMPfam: PF00931
IPR002182
180-431 NB-ARC,NBS
NB-ARC

VGKTTLAQMVFNDDRTRQLFEIQAWVYVSLKFDINTIGQSIISQLDKSSSPSGIPLQATRGRLKTIVTGQRFLIILDDIWEEDPHELEKLWTLLRGAKAGSKIIATTRSVKVAKLMNGSLTIELSALPDNYCWELFRKKAFPYGKVDVDKESIGRQIVMKCRGMPLAAISLGYLCRTTNEWKAILDSDIWAENGDDGRLLKDTKVLPSLKLSYQCMSYHLKLCFAYCAIFPKGWYIEKSSLIQQWIALGFLQ

superfamily: SSF52540
180-374 SSF52540

VGKTTLAQMVFNDDRTRQLFEIQAWVYVSLKFDINTIGQSIISQLDKSSSPSGIPLQATRGRLKTIVTGQRFLIILDDIWEEDPHELEKLWTLLRGAKAGSKIIATTRSVKVAKLMNGSLTIELSALPDNYCWELFRKKAFPYGKVDVDKESIGRQIVMKCRGMPLAAISLGYLCRTTNEWKAILDSDIWAENGD

Gene3D: G3DSA:3.40.50.300
180-299 G3DSA:3.40.50.300

VGKTTLAQMVFNDDRTRQLFEIQAWVYVSLKFDINTIGQSIISQLDKSSSPSGIPLQATRGRLKTIVTGQRFLIILDDIWEEDPHELEKLWTLLRGAKAGSKIIATTRSVKVAKLMNGSL

FPrintScan: PR00364
IPR000767
245-259 DISEASERSIST
Disease resistance protein

IVTGQRFLIILDDIW

FPrintScan: PR00364
IPR000767
340-354 DISEASERSIST
Disease resistance protein

CRGMPLAAISLGYLC

superfamily: SSF52058
480-935 SSF52058,LRR

QMHDLVRELARLVAGDEVVAFDTRKQNPPTNIDNCRYMLLSNLCNSSSSYWSIPSTSRALHFKECSIVQTTLKSLMGAEFLRVLDFSACAISDLPASVGNLRLLKFLNISGMQTGLLPKPLSSLHGLQALNLSENTCLIELPSYISEFVNLQYLDLHGCSNLEELPQGIHKLKELLHLNVSRCGRLQFLPEEFGELRKLAFLNLSYCSQLQTLPSNFGGLQDLSYLNLLHCYKLHGLPDSFIYLANMIHLNMSFCRQLKLLPSGLFKYMKKLLVLNLSGCTSLEVLPEFCNIDAGCRMLKTLELPDCTNLAVLPKSCTSLCELRCLNLSGCSRIQNFLNLIPQWKFGKLEYLNLSEVGAKAYFEDPGTSAGNVGSSEDPNRELELGMLQEDIVTQRLVYLKYLSVGGFTLFSEQGIASLVDLLTLPNFDVQTQPGDNQSNIKLLQQILDLTHHELN

Gene3D: G3DSA:3.80.10.10
525-811 G3DSA:3.80.10.10

SSSSYWSIPSTSRALHFKECSIVQTTLKSLMGAEFLRVLDFSACAISDLPASVGNLRLLKFLNISGMQTGLLPKPLSSLHGLQALNLSENTCLIELPSYISEFVNLQYLDLHGCSNLEELPQGIHKLKELLHLNVSRCGRLQFLPEEFGELRKLAFLNLSYCSQLQTLPSNFGGLQDLSYLNLLHCYKLHGLPDSFIYLANMIHLNMSFCRQLKLLPSGLFKYMKKLLVLNLSGCTSLEVLPEFCNIDAGCRMLKTLELPDCTNLAVLPKSCTSLCELRCLNLSGCS

HMMPfam: PF00560
IPR001611
629-650 LRR_1
Leucine-rich repeat

NLQYLDLHGCSNLEELPQGIHK

HMMPfam: PF00560
IPR001611
677-699 LRR_1
Leucine-rich repeat

KLAFLNLSYCSQLQTLPSNFGGL

FPrintScan: PR00364
IPR000767
746-762 DISEASERSIST
Disease resistance protein

KYMKKLLVLNLSGCTSL

HMMPfam: PF00560
IPR001611
750-770 LRR_1
Leucine-rich repeat

KLLVLNLSGCTSLEVLPEFCN

HMMPfam: PF00560
IPR001611
802-828 LRR_1
Leucine-rich repeat

LRCLNLSGCSRIQNFLNLIPQWKFGKL

superfamily: SSF52047
935-1587 SSF52047,LRR

NIKCLENVVSPEEAKQVELGRNQQLHFLSLEWSSSDIGSSIGKDRLTKATEVLEHLKPHQNLQHLSIKGYSGTIFPDWINNINDALPNLVKIILSDLKGCDHIPALGNLPNLQELEINDMPLLGHVRIVPCKKLRRLALVNLREYTTVHIFYDDNTETQVNEVVELSHDCDKVEKLTGDEIRLHEVASSCDCSEEERKTAEKTDELAGSLPSNRQSKRKWHIMACEGQDLKSMVGARALRVKVKDLLKGPYCGKWRETYITQDTAGAGNDSPAVMSSKPALTPGPSNETTEQAAVPTLDYFKIESCQNLRLYPYYIPMCEELFINDSSIDLDDMEQESSESPAVTSSRPALTPGPSIETREQAVPRLDLFKLESSQNLQLYPYYIPMCEELFIKDSSLDLDDMEQELSESPAVTSSRPALTPGPSIETREQAAVPTLDYFKLESSQNLQLYPYYSPMSEELFIKDSSLDLDDMESESPGMLGQELSYGMYEGEFGSLMHGRDPTSRRYRSESISGTSRKLKIANCNQLSLGRLLLLLKSSLQELEIDSMERIDDSMRGRYMDKWESISGTLRKLKITNCNQHIVNRLLLLFKSSLQELEIDGIKSIDALPSNLFEMTRLEKITISSLELQEAKGSNNIRKQLYVSGIAYINTR

Gene3D: G3DSA:3.80.10.10
937-1078 G3DSA:3.80.10.10

KCLENVVSPEEAKQVELGRNQQLHFLSLEWSSSDIGSSIGKDRLTKATEVLEHLKPHQNLQHLSIKGYSGTIFPDWINNINDALPNLVKIILSDLKGCDHIPALGNLPNLQELEINDMPLLGHVRIVPCKKLRRLALVNLRE

Gene3D: G3DSA:3.80.10.10
1118-1119 G3DSA:3.80.10.10

HE

Gene3D: G3DSA:3.80.10.10
1505-1569 G3DSA:3.80.10.10

LRKLKITNCNQHIVNRLLLLFKSSLQELEIDGIKSIDALPSNLFEMTRLEKITISSLELQEAKGS


List of References

Andrew H Paterson, John E Bowers, Rémy Bruggmann, Inna Dubchak, Jane Grimwood, Heidrun Gundlach, Georg Haberer, Uffe Hellsten, Therese Mitros, Alexander Poliakov, Jeremy Schmutz, Manuel Spannagl, Haibao Tang, Xiyin Wang, Thomas Wicker, Arvind K Bharti, Jarrod Chapman, F Alex Feltus, Udo Gowik, Igor V Grigoriev, Eric Lyons, Christopher A Maher, Mihaela Martis, Apurva Narechania, Robert P Otillar, Bryan W Penning, Asaf A Salamov, Yu Wang, Lifang Zhang, Nicholas C Carpita, Michael Freeling, Alan R Gingle, C Thomas Hash, Beat Keller, Patricia Klein, Stephen Kresovich, Maureen C McCann, Ray Ming, Daniel G Peterson, Mehboob-ur-Rahman, Doreen Ware, Peter Westhoff, Klaus F X Mayer, Joachim Messing, Daniel S Rokhsar
The Sorghum bicolor genome and the diversification of grasses.
Nature: 2009, 457(7229);551-6
PubMed:19189423 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox