PRGDB00063808 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 239825518 (CM000765)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor chromosome 6, whole genome shotgun sequence.

DNA Sequence

ATGGAGACTGTTGCCGTCAAGGCTGCAGGTTCGGTGGTGGGAAAAGCGCTGGGCGCCGTCACGGGCACCTTGCTGGAGGCATGGGCGTCCAGCAAAGGGCTCGGCCCGAACGTCGATGCCCTCAAGGTGGAGCTGCTGTACGCGCAGGCCATGCTGGACAACACGCAGGGAAGGGAGATCCACAGCCCCGCGCTCAAGGAGCTGCTGCTTAGGCTGCAGCAGCTGGCGTATAGCGCCGACGACGTGCTCGACGAGATCGAGTACTTCCGTATCCAGGACGAGCTCGACGGCACCTACCATGCCGCCGATGCGCACGCCGGCGGTTGCTTCCGCGACCTCATCCTGAACGCCCGCCATGTCGCTGGAGCTGTCGCTGCTATGCTCAAGCCTTCGTCCTGCGGTTCACGTCACGGTCACACGATATCCGCGAACTTGACGATCCAAAACAGGGATGCCTTTCTAGCATCGTCTGCTGCTCGTGTGGCAGCTCTCCCACCAGCCAGGATGAGCAGAATAATAAGGTCCATGGCGGATGCATGCAGAAGTTGGCTTCCAATGCTAGCACCGCTGCATGTCCTGGTGTCTGACATATATGTGGTTTCCAACACAACAGGAAATGGGCGAGGATTCTTCTCCTGTGCTGCCTTGCCTTCAAAGGTAAAGGGATGCCTGTGTGGCAAGCGGGAGATGACGAGCTCGTCGCCGGCATCACCCAACACTAACCAGTGCGAGAAGAAGACTGGGTGTGGATGCCTGCTGAAGCTCACACCTACTGCTTGTGACACTTCCAAGTCTGTCGGTAAATGCCTTCCGTGCTTCTCTTTTCAATCTGTTGATGGAAATGTTCACAACAGCATGTCGGACAATCCAGACATGCTAGGAAAAGAGAAGCGGTTTCTATGTGGTGCCTGGACGGCGTCCAAGGCACAACAGAGAAAAGACACTGAACAAGCACCAAAATTGAAGTTTAATAGGGTGGGGGTCTCTGCAAAAATGGAGGAGATCACAGAGCACCTCAAGTATGTATGTGCTAAGGTCTCCAACGTTCTTAACCTAGAGTTCATGGGCACTAGTCGTATCACTAGAAAAGACCTTGCTAACAAACGGCCTATAACCACCCCAGAAATTACAGAACCTCAATTATATGGGAGAGAACAACAAAAGAAAATAATATATGACATTATTGACCGTGGTAACTCTTCTGCTGATAATGATCTAGTTGTGCTTCCGATTCTTGGTCCTGGAGGCATTGGAAAGACAACTTTTACACAGCATGTATATGAAGAAGTGAAGTGCAATTTTGAGGTCACAATTTGGGTATGTGTCTCCCTCAATTTTAGTGCTGGTAGGTTGGCGCAAGAAGCCGTGAAAAAAATTCCTAAAGTTGGCAATGAAAAGGAAAATAGCAGTGTGGAAGAGCTAATCGAACAAAGATTGAAAGCTAAGCGGTTTTTGCTTGTACTAGATGATATGTGGGCATGCCATGAGGATGAATGGAAAAAATTGTTAGCGCCATTTCGAAGAGGGGGAGGAAAAGGTAGTATGGTAATAGTGACCACTCGGATTCCTAAGGTGGCAGAAATGGTTACTAAGACAGTTCACTGTCCAATAATAGAAATGGAGCGCTTAGAGGGTGAAGATTTTATGCACTTTTTTGAAGCTTGCATATTTGGTGGTCAGCAGCCATGGGAAGGTCCCACAGCCTTATTACGTGAGGTTGGGGAAAATATAACTAAAGTTCTAGATAGCAAAGAATGGGAATTCCAAACCAATGATGATAATGACATTATGCCTGCATTAAAACTTAGCTATGATTATCTTCCTTTCCATCTGCAACAATGCTTTTACTATTGTGCTTTGTTTCCTGAAGACTATGAATTTGACAGTAAAGAATTAGTTCTCTTGTGGATAGGACTAGATATTGTTCATCCATGTGATGATGTAAACCAAACAGTTGAAGAAACTGGACAGAGATATTTAGATGACTTGGTTAATCATGGTTTTTTCAAAAAATCTTTAGGAAATGATGGTTGTGATTATTATGTTGTCCATGACCTACTACATAATTTGGCTGTGAATATTTCGTCATTTGAATGTCTCAGCATATGTAGCTCCAACGTGAAGTCAATACATATTCGCCAAGATATACGTCACTTGTCTATCATCATAGATGACAAGGATGTTGAGGACATCAAGACTTTCAAGTACTATAAAAATGACTTGAGTACACTTGATAAAAGATTAAATGTTGAAAACCTACGTACCTTGATGGTGTTTGGAGGACACCAAGAAAGCTTTGCCAAGATGTTTTGTGATTTATTTGAGAAACCTAGAGCCCTTCGTGCTATTTATTTATCTGGAGTATCGTCATATACTATGGAGGATATGTTGCATGAGTTCCCAAAGCATATTCATCTTTGCTACCTAAGGATTAAATTGGCTGATGACACGGAAGACATAGACTTTGATCTTAGTGCCCTAACTAGACTTTATCATTTAGAGATCCTAGATATGCAAAAATGCAAAGGTCGCTATGGTTTCACAAGACATATTAGCAACCTTGCAAAGTTGCGACACTTTCTGGTGCCACAAGATGAACTTCAACTTCATTCCAACATAGTTGAGGTGGGGAAACTAAAACTATTGCAAGAGTTAAGGAGCTTTGAAGTTGGAAGAGAAACTAAGGGTTTTGAACTAAGTCAGCTTGGGAAATTGTCAGAACTTGGAGGCTCACTTTCCATTTGTAGTCTTGAAAGGATACGAGCGATAGAGGATGCACATGAGGCCAGATTGACACAAATAAAACATTTGCACAAGCTAACACTAGAATGGGATGCCAATCGATCTGAAAAAAATACTACACATGAAGAAAATATACTGGAGATTCTTACACCATGTAGCAATCTTAAAGACCTTTGCATTAGAGGCCATGGAGGCACCAAATGCCCAAAATGGCTAGGTGAGGACCTCTCTGTCAAAAATCTGGAATCCCTTCATCTAGATGGCGTAGCTTGGAATACATTTCCACCCATAGGAGAGTTGTGGCTAGTTAATGGACCTCACCAAGAAATTTCAAGTAATATCCACCATGAAAAGTTTCACAATTTGAGGAGGTTGGAGCTAGTTAATCTACCAAGGTTGAAAAACTGGGTCGTCAGTGCACCTTGTCATTTGTTTGCTCACTTGGAAGTGCTTATCATTAGGGATTGCTTTGAACTAACCGATATCTCATTTTCACATTCTACTTGCTGTCAACGAGAGAGAGAGGAAGAGGCCAACATGAATTGGTTTCCTCGTGGTCTACAAGAGCTTGACATTGAAAGTTGTCCAAAACTGTTGTCCGTTCCTCCTGTTCCTTGGACCAGTACTTTGTGCTCTACTAAGATAAAAGGAGTTGCTTTGGGTTTTGAGAATTTAGTTTGTAAAGCAAACAAAAAGTGGGGATATTGCTTGAACATTAAAGCAACTGTTGCTTTAGATGATGGCACATTCTGGAACGTGTTAGCCTTTGATAATCTAATGGAACTAAAACGGTGGAATGCTAGTGCAAAGGAATTGACGCAGCTACTGACTTATTTTCCTGAGCTATCTGAACTGAACATGCGGTCATGTGATCAGATTACAGGGCTAGCTGTAGTGGAGAAGCGGACAGCAGAAACACCCGCACCAGAATCTTCAGATAATAATAAAGTGGACGACCAGCAGCAGGATGGCACAAGAGGGGAGGAGGAAATAGCCACATCATCAGCGGAAGGGCTGCTGCTCTTGCCTTCCCAACTACAGACACTGCGGATCCTATACTGCCGAAAGCTAAGCCTCTGCTCCAATTCAATCGACCACAACAGAGAATCAGGACGACCTGGTGGAGGACAAGGGCTCCAAGGTCTATGCTTCCTCCGATCCTTGCAGATAATCTATTGCCCCAGGTTTCTCTGCTCCTATTCGTCATCCTCCTCTTCTTCGTGGTTCCCCTTCCCAACCTCCCTGGAACGCCTCTGTCTTTTGGGCGCGGTGGGCACAGCAACCCCGTTGCCTCTCTCAAACCTCGCCTCTCTCACAGATTTAACCATATGGGAATGTGGGGATTTAAGAGGTGAGGGACTGCGGCATCTCCTCGCCCAAGGTCGTCTCACCATATTATCCGTCCGTGGAACCCCCAATTTCTGGGCTGGTCCCGAACCCCCGCTGCCCCATGAACAAGAGTTCTCATCCTCTTCCTCCAAACTGCAGAAGCTTGAGACAGATGACGTGGCGGGCGTCCTTGCTGCGCCCATCTGTACCTTGCTCTCTTCCTCGCTCACCGAATTGACATTTCACGACGACAAAGAGGTGGAGCGCTTCACAAAGGAGCAAGAGGACGCCCTTCAGCTCCTCACCTCTCTCGAGATCACATTTTGGGACTGCGACAAGCTCCAGTGCCTCCCTGCTGGGCTTCATGGACTCCCCAACCTCAAGAAATTAAACATATATAGTTGTCCAACCATCCGATCGCTGCCCAAGGATGGCCTCCCAAGTTCACTGCAAGTGTTAGTGATAGACGACTGTCCAGCCATCCAGTCTCTACCTAAGGACTGCCTCCCAACTTCACTGCAAAAATTAGAGATCCATAGCTGCCCAGCCATCCGGTCTCTGCCCAAGGATGGCCTCCCAATTTCACTGCAAAAATTGGAGATCGATGACTGCCCAAACATTCGATCACTGCCCAAGGTGAATGACCTTCCAAGTTCATTGCGAGAATTGAATGTCCAACGTAGCAAAAGCGAGGAGCTAAGAAGGCAGTGCCGCAAGTTGATTGGAATCATTCCAGTTGTCTACGCCTGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein SORBIDRAFT_06g029250 [Sorghum bicolor].

METVAVKAAGSVVGKALGAVTGTLLEAWASSKGLGPNVDALKVELLYAQAMLDNTQGREIHSPALKELLLRLQQLAYSADDVLDEIEYFRIQDELDGTYHAADAHAGGCFRDLILNARHVAGAVAAMLKPSSCGSRHGHTISANLTIQNRDAFLASSAARVAALPPARMSRIIRSMADACRSWLPMLAPLHVLVSDIYVVSNTTGNGRGFFSCAALPSKVKGCLCGKREMTSSSPASPNTNQCEKKTGCGCLLKLTPTACDTSKSVGKCLPCFSFQSVDGNVHNSMSDNPDMLGKEKRFLCGAWTASKAQQRKDTEQAPKLKFNRVGVSAKMEEITEHLKYVCAKVSNVLNLEFMGTSRITRKDLANKRPITTPEITEPQLYGREQQKKIIYDIIDRGNSSADNDLVVLPILGPGGIGKTTFTQHVYEEVKCNFEVTIWVCVSLNFSAGRLAQEAVKKIPKVGNEKENSSVEELIEQRLKAKRFLLVLDDMWACHEDEWKKLLAPFRRGGGKGSMVIVTTRIPKVAEMVTKTVHCPIIEMERLEGEDFMHFFEACIFGGQQPWEGPTALLREVGENITKVLDSKEWEFQTNDDNDIMPALKLSYDYLPFHLQQCFYYCALFPEDYEFDSKELVLLWIGLDIVHPCDDVNQTVEETGQRYLDDLVNHGFFKKSLGNDGCDYYVVHDLLHNLAVNISSFECLSICSSNVKSIHIRQDIRHLSIIIDDKDVEDIKTFKYYKNDLSTLDKRLNVENLRTLMVFGGHQESFAKMFCDLFEKPRALRAIYLSGVSSYTMEDMLHEFPKHIHLCYLRIKLADDTEDIDFDLSALTRLYHLEILDMQKCKGRYGFTRHISNLAKLRHFLVPQDELQLHSNIVEVGKLKLLQELRSFEVGRETKGFELSQLGKLSELGGSLSICSLERIRAIEDAHEARLTQIKHLHKLTLEWDANRSEKNTTHEENILEILTPCSNLKDLCIRGHGGTKCPKWLGEDLSVKNLESLHLDGVAWNTFPPIGELWLVNGPHQEISSNIHHEKFHNLRRLELVNLPRLKNWVVSAPCHLFAHLEVLIIRDCFELTDISFSHSTCCQREREEEANMNWFPRGLQELDIESCPKLLSVPPVPWTSTLCSTKIKGVALGFENLVCKANKKWGYCLNIKATVALDDGTFWNVLAFDNLMELKRWNASAKELTQLLTYFPELSELNMRSCDQITGLAVVEKRTAETPAPESSDNNKVDDQQQDGTRGEEEIATSSAEGLLLLPSQLQTLRILYCRKLSLCSNSIDHNRESGRPGGGQGLQGLCFLRSLQIIYCPRFLCSYSSSSSSSWFPFPTSLERLCLLGAVGTATPLPLSNLASLTDLTIWECGDLRGEGLRHLLAQGRLTILSVRGTPNFWAGPEPPLPHEQEFSSSSSKLQKLETDDVAGVLAAPICTLLSSSLTELTFHDDKEVERFTKEQEDALQLLTSLEITFWDCDKLQCLPAGLHGLPNLKKLNIYSCPTIRSLPKDGLPSSLQVLVIDDCPAIQSLPKDCLPTSLQKLEIHSCPAIRSLPKDGLPISLQKLEIDDCPNIRSLPKVNDLPSSLRELNVQRSKSEELRRQCRKLIGIIPVVYA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
332-1048 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MEEITEHLKYVCAKVSNVLNLEFMGTSRITRKDLANKRPITTPEITEPQLYGREQQKKIIYDIIDRGNSSADNDLVVLPILGPGGIGKTTFTQHVYEEVKCNFEVTIWVCVSLNFSAGRLAQEAVKKIPKVGNEKENSSVEELIEQRLKAKRFLLVLDDMWACHEDEWKKLLAPFRRGGGKGSMVIVTTRIPKVAEMVTKTVHCPIIEMERLEGEDFMHFFEACIFGGQQPWEGPTALLREVGENITKVLDSKEWEFQTNDDNDIMPALKLSYDYLPFHLQQCFYYCALFPEDYEFDSKELVLLWIGLDIVHPCDDVNQTVEETGQRYLDDLVNHGFFKKSLGNDGCDYYVVHDLLHNLAVNISSFECLSICSSNVKSIHIRQDIRHLSIIIDDKDVEDIKTFKYYKNDLSTLDKRLNVENLRTLMVFGGHQESFAKMFCDLFEKPRALRAIYLSGVSSYTMEDMLHEFPKHIHLCYLRIKLADDTEDIDFDLSALTRLYHLEILDMQKCKGRYGFTRHISNLAKLRHFLVPQDELQLHSNIVEVGKLKLLQELRSFEVGRETKGFELSQLGKLSELGGSLSICSLERIRAIEDAHEARLTQIKHLHKLTLEWDANRSEKNTTHEENILEILTPCSNLKDLCIRGHGGTKCPKWLGEDLSVKNLESLHLDGVAWNTFPPIGELWLVNGPHQEISSNIHHEKFHNLRRLELVNLPRLK

HMMPanther: PTHR11017:SF28
332-1048 PTHR11017:SF28

MEEITEHLKYVCAKVSNVLNLEFMGTSRITRKDLANKRPITTPEITEPQLYGREQQKKIIYDIIDRGNSSADNDLVVLPILGPGGIGKTTFTQHVYEEVKCNFEVTIWVCVSLNFSAGRLAQEAVKKIPKVGNEKENSSVEELIEQRLKAKRFLLVLDDMWACHEDEWKKLLAPFRRGGGKGSMVIVTTRIPKVAEMVTKTVHCPIIEMERLEGEDFMHFFEACIFGGQQPWEGPTALLREVGENITKVLDSKEWEFQTNDDNDIMPALKLSYDYLPFHLQQCFYYCALFPEDYEFDSKELVLLWIGLDIVHPCDDVNQTVEETGQRYLDDLVNHGFFKKSLGNDGCDYYVVHDLLHNLAVNISSFECLSICSSNVKSIHIRQDIRHLSIIIDDKDVEDIKTFKYYKNDLSTLDKRLNVENLRTLMVFGGHQESFAKMFCDLFEKPRALRAIYLSGVSSYTMEDMLHEFPKHIHLCYLRIKLADDTEDIDFDLSALTRLYHLEILDMQKCKGRYGFTRHISNLAKLRHFLVPQDELQLHSNIVEVGKLKLLQELRSFEVGRETKGFELSQLGKLSELGGSLSICSLERIRAIEDAHEARLTQIKHLHKLTLEWDANRSEKNTTHEENILEILTPCSNLKDLCIRGHGGTKCPKWLGEDLSVKNLESLHLDGVAWNTFPPIGELWLVNGPHQEISSNIHHEKFHNLRRLELVNLPRLK

superfamily: SSF52540
364-562 SSF52540

DLANKRPITTPEITEPQLYGREQQKKIIYDIIDRGNSSADNDLVVLPILGPGGIGKTTFTQHVYEEVKCNFEVTIWVCVSLNFSAGRLAQEAVKKIPKVGNEKENSSVEELIEQRLKAKRFLLVLDDMWACHEDEWKKLLAPFRRGGGKGSMVIVTTRIPKVAEMVTKTVHCPIIEMERLEGEDFMHFFEACIFGGQQP

Gene3D: G3DSA:3.40.50.300
383-524 G3DSA:3.40.50.300

GREQQKKIIYDIIDRGNSSADNDLVVLPILGPGGIGKTTFTQHVYEEVKCNFEVTIWVCVSLNFSAGRLAQEAVKKIPKVGNEKENSSVEELIEQRLKAKRFLLVLDDMWACHEDEWKKLLAPFRRGGGKGSMVIVTTRIPK

HMMPfam: PF00931
IPR002182
395-577 NB-ARC,NBS
NB-ARC

IDRGNSSADNDLVVLPILGPGGIGKTTFTQHVYEEVKCNFEVTIWVCVSLNFSAGRLAQEAVKKIPKVGNEKENSSVEELIEQRLKAKRFLLVLDDMWACHEDEWKKLLAPFRRGGGKGSMVIVTTRIPKVAEMVTKTVHCPIIEMERLEGEDFMHFFEACIFGGQQPWEGPTALLREVGENI

FPrintScan: PR00364
IPR000767
408-423 DISEASERSIST
Disease resistance protein

VLPILGPGGIGKTTFT

FPrintScan: PR00364
IPR000767
478-492 DISEASERSIST
Disease resistance protein

RLKAKRFLLVLDDMW

HMMPfam: PF00931
IPR002182
578-644 NB-ARC,NBS
NB-ARC

TKVLDSKEWEFQTNDDNDIMPALKLSYDYLPFHLQQCFYYCALFPEDYEFDSKELVLLWIGLDIVHP

superfamily: SSF52058
682-1205 SSF52058,LRR

VVHDLLHNLAVNISSFECLSICSSNVKSIHIRQDIRHLSIIIDDKDVEDIKTFKYYKNDLSTLDKRLNVENLRTLMVFGGHQESFAKMFCDLFEKPRALRAIYLSGVSSYTMEDMLHEFPKHIHLCYLRIKLADDTEDIDFDLSALTRLYHLEILDMQKCKGRYGFTRHISNLAKLRHFLVPQDELQLHSNIVEVGKLKLLQELRSFEVGRETKGFELSQLGKLSELGGSLSICSLERIRAIEDAHEARLTQIKHLHKLTLEWDANRSEKNTTHEENILEILTPCSNLKDLCIRGHGGTKCPKWLGEDLSVKNLESLHLDGVAWNTFPPIGELWLVNGPHQEISSNIHHEKFHNLRRLELVNLPRLKNWVVSAPCHLFAHLEVLIIRDCFELTDISFSHSTCCQREREEEANMNWFPRGLQELDIESCPKLLSVPPVPWTSTLCSTKIKGVALGFENLVCKANKKWGYCLNIKATVALDDGTFWNVLAFDNLMELKRWNASAKELTQLLTYFPELSELNMRSCD

Gene3D: G3DSA:3.80.10.10
719-886 G3DSA:3.80.10.10

LSIIIDDKDVEDIKTFKYYKNDLSTLDKRLNVENLRTLMVFGGHQESFAKMFCDLFEKPRALRAIYLSGVSSYTMEDMLHEFPKHIHLCYLRIKLADDTEDIDFDLSALTRLYHLEILDMQKCKGRYGFTRHISNLAKLRHFLVPQDELQLHSNIVEVGKLKLLQELR

FPrintScan: PR00364
IPR000767
828-844 DISEASERSIST
Disease resistance protein

TRLYHLEILDMQKCKGR

Gene3D: G3DSA:3.80.10.10
961-1109 G3DSA:3.80.10.10

EILTPCSNLKDLCIRGHGGTKCPKWLGEDLSVKNLESLHLDGVAWNTFPPIGELWLVNGPHQEISSNIHHEKFHNLRRLELVNLPRLKNWVVSAPCHLFAHLEVLIIRDCFELTDISFSHSTCCQREREEEANMNWFPRGLQELDIESC

Gene3D: G3DSA:3.80.10.10
1179-1209 G3DSA:3.80.10.10

WNASAKELTQLLTYFPELSELNMRSCDQITG

superfamily: SSF52058
1238-1568 SSF52058,LRR

GTRGEEEIATSSAEGLLLLPSQLQTLRILYCRKLSLCSNSIDHNRESGRPGGGQGLQGLCFLRSLQIIYCPRFLCSYSSSSSSSWFPFPTSLERLCLLGAVGTATPLPLSNLASLTDLTIWECGDLRGEGLRHLLAQGRLTILSVRGTPNFWAGPEPPLPHEQEFSSSSSKLQKLETDDVAGVLAAPICTLLSSSLTELTFHDDKEVERFTKEQEDALQLLTSLEITFWDCDKLQCLPAGLHGLPNLKKLNIYSCPTIRSLPKDGLPSSLQVLVIDDCPAIQSLPKDCLPTSLQKLEIHSCPAIRSLPKDGLPISLQKLEIDDCPNIRSLP

Gene3D: G3DSA:3.80.10.10
1291-1360 G3DSA:3.80.10.10

QGLQGLCFLRSLQIIYCPRFLCSYSSSSSSSWFPFPTSLERLCLLGAVGTATPLPLSNLASLTDLTIWEC

Gene3D: G3DSA:3.80.10.10
1403-1584 G3DSA:3.80.10.10

SSSSSKLQKLETDDVAGVLAAPICTLLSSSLTELTFHDDKEVERFTKEQEDALQLLTSLEITFWDCDKLQCLPAGLHGLPNLKKLNIYSCPTIRSLPKDGLPSSLQVLVIDDCPAIQSLPKDCLPTSLQKLEIHSCPAIRSLPKDGLPISLQKLEIDDCPNIRSLPKVNDLPSSLRELNVQR


List of References

Andrew H Paterson, John E Bowers, Rémy Bruggmann, Inna Dubchak, Jane Grimwood, Heidrun Gundlach, Georg Haberer, Uffe Hellsten, Therese Mitros, Alexander Poliakov, Jeremy Schmutz, Manuel Spannagl, Haibao Tang, Xiyin Wang, Thomas Wicker, Arvind K Bharti, Jarrod Chapman, F Alex Feltus, Udo Gowik, Igor V Grigoriev, Eric Lyons, Christopher A Maher, Mihaela Martis, Apurva Narechania, Robert P Otillar, Bryan W Penning, Asaf A Salamov, Yu Wang, Lifang Zhang, Nicholas C Carpita, Michael Freeling, Alan R Gingle, C Thomas Hash, Beat Keller, Patricia Klein, Stephen Kresovich, Maureen C McCann, Ray Ming, Daniel G Peterson, Mehboob-ur-Rahman, Doreen Ware, Peter Westhoff, Klaus F X Mayer, Joachim Messing, Daniel S Rokhsar
The Sorghum bicolor genome and the diversification of grasses.
Nature: 2009, 457(7229);551-6
PubMed:19189423 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox