PRGDB00063820 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 239825520 (CM000763)
Gene Class Unknown
Domain Type LRR
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor chromosome 4, whole genome shotgun sequence.

DNA Sequence

CCAAGAACTTGTTCTGGAATCTTTTGGGCTTATGACAGCGGAATCCAAGGTCCTATCCCTGACACAATTGGTAACTTGACCTCCCTACAATATTTGAATCTTTACAATAACAGCATCACTGGCCCTTTGCCATCCACCATAGGGACTCTAAAGAAAATACAAACCCTGCAACTATCGAAGAACTTCATCAGCATGGACATAGCAGAACTACTGCGTAGGTTGCCAAAGCAAGGGTTGCAACAACTCTTCTTGAATTATAACAATTTGACAGGGAGCTTGCCACCTCTGATTGGGGAGTTTAGCAGTTTGACAAGTCTTTGGATCCAACACAATCATCTGTCAGGAGATATACCTGTTGCAATACGGAAACTCATAAATTTGGAAGAGCTGTGGCTAAGCTCAAATAACCTGCAGGGTATAATCACTGAAGATCATTTTACAAATATGTCTTCTCTACAACATCTCTGGATATCTGATAATTCCTTGACTTTGCGGGTAGAGAATACATGGAACACCCCATTCAGATTAATTTCAGCTGGCTTTAGCTCTTGTGTGCTAGGGCCTCAATTTCCAGCATGGCTCAGCAGTCAGCCAATTAACACACTAGATATTTCAAACACAAGCATAAATGATTACATACCTGATGAGTTTTGGACTGCGACTTTAAGTACTATCAGTGTTTTGGATTTGTCAAGAAATCAGCTTGTTGGCAGGCTTCCCACATATTTCGGCAGTTTGAGAGTATCTTCATTGGACATCAGTTCTAACCAACTTGTTGGCCCGATTCCTAAACTTCCAAACAATCTATACTACTTAGACCTCTCTGAAAACAATATATCAGGCAAACTGCCATCGGATATTGGGGCACCAATGCTGGGAACACTACTTCTCTTCAATAATTCGATTTCTGGAACCATTCCTTGCTCCTTGCTTCAGTTGCAACAGTTGAAATTTCTGGACCTATCAGAAAACCTACTAAACGAGACATTGCCCAATTGCCTTCATGGGTCTGAAGCATCAACTATTCAGTTGCTCAACTTGAATAGCAACAACCTTTCAGGAACATTCCCTTTGTTTCTTCAGAGTTGTAAACAGTTAAAATTTCTTGATCTAGCATACAATAAATTTTCTGGGAGCATACCATCATGGATTGGGGAAATTTCATCGGATTTGTCGTTTTTACGGCTACGCTCAAATATGTTTTCTGGTGGCATTCCCATCCAAATCACTAGGATGAAGGGGCTTCAATATCTAGACCTTGCATGTAACAACTTCACAGGGAACATACCACTGTCACTTGGAAACCTGGAAGCTATGGCTCATACTCCCAATAACAATAGTGCACTTTTCAGTGTTACCAACACTGGATTTGTTGGTGTTTTCCTGTACAGACCTGTACGAACTGATAGTTTATTAGTGGTCACCAAAGGTCAACAGCTTGAATTTGCAAGTGGAATTGCTTACATGGTAAGCATTGATTTGTCTTGCAACAGTTTAACAGGGCAAATACCTGAAGAAGTTGGGCTGCTCATTGCACTGAGAAACTTGAACTTGTCATGGAATCATCTCAGCAGCAGAATCCCCTCAAGTATTGGGGGACTACTTGCGCTAGAATCTTTTGATCTATCTCATAATGAGCTCTCTGGTGAAATCCCTAACAGTTTGTCTGACCTAACATCACTGGTCAGCTTGAACTTGTCCTATAATGATTTAACTGGGCAGATACCATCTGGGAATCAACTGAGAACTCTGGAGAACCAGGCATCCAGCTATATTGGCAACCCAGGTCTCTGCGGTCCACCTCTCCCCAACAATTGTTCAGCAACTGACACGGCTCCGAGTGGCCCTGAAGAGAAAGAAGTTTCCTTATACCTCGGCATGGGCATAGGATGTGTTATGGGTCTTTGGATAGTCTTCATTGCCCTCTTGTTCAAGAGAAAATGGAGAATCATTTGCTTCTCATTTACGGACCACATGTATGACTGGGTTTACGTGCAAGTGGCTGTGAACTGGGCTACAATGACACGAAAAACCTGTCAAAACAGAGATCAGAATTAAATGGCTGTGCGCAATCCAAAAATGGCCAGGCACTTGATCCAAGTTACAGTAATAATTCTTTCCATGTGTTGCCTCCTCGTCGTTGCCCAGCAAAGCTCATCAGCCCCAGCAGCGCCTGCACCTGCACCTGCACTCCCACCAAGCACTCTCTGCATCCCCCGAGAGCGTGATGCCCTGCTTGTCCTCAAAGCTGGCCTCACAGATCCGGGCAACTACCTGTCGTCTTGGCAAGCAGGGCAAGACTGCTGCCGGTGGAGTGGCATTCAGTGCAGCAACCGAACCGGCCATGTCATCCAGCTCCAGATCAACAGCAAGGATCCTGACGCCAAACAGTCTGTGGGACTGGGAACCATAGGAGGCGAGGTGAGCTCGTCCTTGCTTTCTTTACGACACTTACAGAAATTGGACCTCTCCTGGAACAACTTTGGTGGTAGACCAATCCCAGAGCTCATCGGTGCCATCAGAAGCTTGATGTATCTTGACCTTAGCTATTCAAATTTCGGTGGGCGAATCCCTCCGCACCTAGGCAACCTCTCAAATTTGCTTGAGCTTACTATATACAACGAAGAAACTTCACAAAGTTTGTACGCCACTGATCTTGCCTGGGTGACACGCCTTGGCAAGCTACAGTCACTCAGTATGTATGGGGTGAACCTCAGCACAGTCATCGATTGGGCTCATGCCATCAACATGCTTTCATCTCTGTCGGACCTTGATCTAAGTTCCTGTGGACTTCAGAACATCATTCCTGCCCCGTTGCAT


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein SORBIDRAFT_04g001610 [Sorghum bicolor].

MAVRNPKMARHLIQVTVIILSMCCLLVVAQQSSSAPAAPAPAPALPPSTLCIPRERDALLVLKAGLTDPGNYLSSWQAGQDCCRWSGIQCSNRTGHVIQLQINSKDPDAKQSVGLGTIGGEVSSSLLSLRHLQKLDLSWNNFGGRPIPELIGAIRSLMYLDLSYSNFGGRIPPHLGNLSNLLELTIYNEETSQSLYATDLAWVTRLGKLQSLSMYGVNLSTVIDWAHAINMLSSLSDLDLSSCGLQNIIPAPLHPRTCSGIFWAYDSGIQGPIPDTIGNLTSLQYLNLYNNSITGPLPSTIGTLKKIQTLQLSKNFISMDIAELLRRLPKQGLQQLFLNYNNLTGSLPPLIGEFSSLTSLWIQHNHLSGDIPVAIRKLINLEELWLSSNNLQGIITEDHFTNMSSLQHLWISDNSLTLRVENTWNTPFRLISAGFSSCVLGPQFPAWLSSQPINTLDISNTSINDYIPDEFWTATLSTISVLDLSRNQLVGRLPTYFGSLRVSSLDISSNQLVGPIPKLPNNLYYLDLSENNISGKLPSDIGAPMLGTLLLFNNSISGTIPCSLLQLQQLKFLDLSENLLNETLPNCLHGSEASTIQLLNLNSNNLSGTFPLFLQSCKQLKFLDLAYNKFSGSIPSWIGEISSDLSFLRLRSNMFSGGIPIQITRMKGLQYLDLACNNFTGNIPLSLGNLEAMAHTPNNNSALFSVTNTGFVGVFLYRPVRTDSLLVVTKGQQLEFASGIAYMVSIDLSCNSLTGQIPEEVGLLIALRNLNLSWNHLSSRIPSSIGGLLALESFDLSHNELSGEIPNSLSDLTSLVSLNLSYNDLTGQIPSGNQLRTLENQASSYIGNPGLCGPPLPNNCSATDTAPSGPEEKEVSLYLGMGIGCVMGLWIVFIALLFKRKWRIICFSFTDHMYDWVYVQVAVNWATMTRKTCQNRDQN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
4-903 PTHR24420,FAMILY NOT NAMED

RNPKMARHLIQVTVIILSMCCLLVVAQQSSSAPAAPAPAPALPPSTLCIPRERDALLVLKAGLTDPGNYLSSWQAGQDCCRWSGIQCSNRTGHVIQLQINSKDPDAKQSVGLGTIGGEVSSSLLSLRHLQKLDLSWNNFGGRPIPELIGAIRSLMYLDLSYSNFGGRIPPHLGNLSNLLELTIYNEETSQSLYATDLAWVTRLGKLQSLSMYGVNLSTVIDWAHAINMLSSLSDLDLSSCGLQNIIPAPLHPRTCSGIFWAYDSGIQGPIPDTIGNLTSLQYLNLYNNSITGPLPSTIGTLKKIQTLQLSKNFISMDIAELLRRLPKQGLQQLFLNYNNLTGSLPPLIGEFSSLTSLWIQHNHLSGDIPVAIRKLINLEELWLSSNNLQGIITEDHFTNMSSLQHLWISDNSLTLRVENTWNTPFRLISAGFSSCVLGPQFPAWLSSQPINTLDISNTSINDYIPDEFWTATLSTISVLDLSRNQLVGRLPTYFGSLRVSSLDISSNQLVGPIPKLPNNLYYLDLSENNISGKLPSDIGAPMLGTLLLFNNSISGTIPCSLLQLQQLKFLDLSENLLNETLPNCLHGSEASTIQLLNLNSNNLSGTFPLFLQSCKQLKFLDLAYNKFSGSIPSWIGEISSDLSFLRLRSNMFSGGIPIQITRMKGLQYLDLACNNFTGNIPLSLGNLEAMAHTPNNNSALFSVTNTGFVGVFLYRPVRTDSLLVVTKGQQLEFASGIAYMVSIDLSCNSLTGQIPEEVGLLIALRNLNLSWNHLSSRIPSSIGGLLALESFDLSHNELSGEIPNSLSDLTSLVSLNLSYNDLTGQIPSGNQLRTLENQASSYIGNPGLCGPPLPNNCSATDTAPSGPEEKEVSLYLGMGIGCVMGLWIVFIALLFKRKWR

Gene3D: G3DSA:3.80.10.10
51-251 G3DSA:3.80.10.10

CIPRERDALLVLKAGLTDPGNYLSSWQAGQDCCRWSGIQCSNRTGHVIQLQINSKDPDAKQSVGLGTIGGEVSSSLLSLRHLQKLDLSWNNFGGRPIPELIGAIRSLMYLDLSYSNFGGRIPPHLGNLSNLLELTIYNEETSQSLYATDLAWVTRLGKLQSLSMYGVNLSTVIDWAHAINMLSSLSDLDLSSCGLQNIIPA

HMMPfam: PF08263
IPR013210
54-91 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

RERDALLVLKAGLTDPGNYLSSWQAGQDCCRWSGIQCS

superfamily: SSF52047
121-417 SSF52047,LRR

EVSSSLLSLRHLQKLDLSWNNFGGRPIPELIGAIRSLMYLDLSYSNFGGRIPPHLGNLSNLLELTIYNEETSQSLYATDLAWVTRLGKLQSLSMYGVNLSTVIDWAHAINMLSSLSDLDLSSCGLQNIIPAPLHPRTCSGIFWAYDSGIQGPIPDTIGNLTSLQYLNLYNNSITGPLPSTIGTLKKIQTLQLSKNFISMDIAELLRRLPKQGLQQLFLNYNNLTGSLPPLIGEFSSLTSLWIQHNHLSGDIPVAIRKLINLEELWLSSNNLQGIITEDHFTNMSSLQHLWISDNSLT

ProfileScan: PS51450
IPR001611
131-154 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQKLDLSWNNFGGRPIPELIGAI

HMMPfam: PF13504
131-143 LRR_7,Leucine rich repeat

HLQKLDLSWNNFG

ProfileScan: PS51450
IPR001611
234-255 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSDLDLSSCGLQNIIPAPLHP

Gene3D: G3DSA:3.80.10.10
268-409 G3DSA:3.80.10.10

GIQGPIPDTIGNLTSLQYLNLYNNSITGPLPSTIGTLKKIQTLQLSKNFISMDIAELLRRLPKQGLQQLFLNYNNLTGSLPPLIGEFSSLTSLWIQHNHLSGDIPVAIRKLINLEELWLSSNNLQGIITEDHFTNMSSLQHL

HMMPfam: PF12799
281-324 LRR_4,Leucine Rich repeats (2 copies)

TSLQYLNLYNNSITGPLPSTIGTLKKIQTLQLSKNFISMDIAEL

ProfileScan: PS51450
IPR001611
282-304 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQYLNLYNNSITGPLPSTIGTL

ProfileScan: PS51450
IPR001611
306-328 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KIQTLQLSKNFISMDIAELLRRL

ProfileScan: PS51450
IPR001611
332-354 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQQLFLNYNNLTGSLPPLIGEF

HMMPfam: PF13855
355-416 LRR_8,Leucine rich repeat

SSLTSLWIQHNHLSGDIPVAIRKLINLEELWLSSNNLQGIITEDHFTNMSSLQHLWISDNSL

ProfileScan: PS51450
IPR001611
356-378 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLWIQHNHLSGDIPVAIRKL

superfamily: SSF52058
372-517 SSF52058,LRR

PVAIRKLINLEELWLSSNNLQGIITEDHFTNMSSLQHLWISDNSLTLRVENTWNTPFRLISAGFSSCVLGPQFPAWLSSQPINTLDISNTSINDYIPDEFWTATLSTISVLDLSRNQLVGRLPTYFGSLRVSSLDISSNQLVGPIP

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELWLSSNNLQGIITEDHFT

ProfileScan: PS51450
IPR001611
405-427 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQHLWISDNSLTLRVENTWNTP

Gene3D: G3DSA:3.80.10.10
410-531 G3DSA:3.80.10.10

WISDNSLTLRVENTWNTPFRLISAGFSSCVLGPQFPAWLSSQPINTLDISNTSINDYIPDEFWTATLSTISVLDLSRNQLVGRLPTYFGSLRVSSLDISSNQLVGPIPKLPNNLYYLDLSEN

ProfileScan: PS51450
IPR001611
478-500 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TISVLDLSRNQLVGRLPTYFGSL

superfamily: SSF52058
519-860 SSF52058,LRR

LPNNLYYLDLSENNISGKLPSDIGAPMLGTLLLFNNSISGTIPCSLLQLQQLKFLDLSENLLNETLPNCLHGSEASTIQLLNLNSNNLSGTFPLFLQSCKQLKFLDLAYNKFSGSIPSWIGEISSDLSFLRLRSNMFSGGIPIQITRMKGLQYLDLACNNFTGNIPLSLGNLEAMAHTPNNNSALFSVTNTGFVGVFLYRPVRTDSLLVVTKGQQLEFASGIAYMVSIDLSCNSLTGQIPEEVGLLIALRNLNLSWNHLSSRIPSSIGGLLALESFDLSHNELSGEIPNSLSDLTSLVSLNLSYNDLTGQIPSGNQLRTLENQASSYIGNPGLCGPPLPNNC

HMMPfam: PF00560
IPR001611
522-541 LRR_1
Leucine-rich repeat

NLYYLDLSENNISGKLPSDI

ProfileScan: PS51450
IPR001611
522-544 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLYYLDLSENNISGKLPSDIGAP

Gene3D: G3DSA:3.80.10.10
532-693 G3DSA:3.80.10.10

NISGKLPSDIGAPMLGTLLLFNNSISGTIPCSLLQLQQLKFLDLSENLLNETLPNCLHGSEASTIQLLNLNSNNLSGTFPLFLQSCKQLKFLDLAYNKFSGSIPSWIGEISSDLSFLRLRSNMFSGGIPIQITRMKGLQYLDLACNNFTGNIPLSLGNLEAM

ProfileScan: PS51450
IPR001611
545-566 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLGTLLLFNNSISGTIPCSLLQ

ProfileScan: PS51450
IPR001611
569-591 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKFLDLSENLLNETLPNCLHGS

ProfileScan: PS51450
IPR001611
595-616 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TIQLLNLNSNNLSGTFPLFLQS

HMMPfam: PF13516
617-639 LRR_6,Leucine Rich repeat

CKQLKFLDLAYNKFSGSIPSWIG

ProfileScan: PS51450
IPR001611
619-641 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKFLDLAYNKFSGSIPSWIGEI

ProfileScan: PS51450
IPR001611
668-691 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQYLDLACNNFTGNIPLSLGNLE

HMMPfam: PF00560
IPR001611
669-690 LRR_1
Leucine-rich repeat

LQYLDLACNNFTGNIPLSLGNL

ProfileScan: PS51450
IPR001611
742-764 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YMVSIDLSCNSLTGQIPEEVGLL

Gene3D: G3DSA:3.80.10.10
743-839 G3DSA:3.80.10.10

MVSIDLSCNSLTGQIPEEVGLLIALRNLNLSWNHLSSRIPSSIGGLLALESFDLSHNELSGEIPNSLSDLTSLVSLNLSYNDLTGQIPSGNQLRTLE

ProfileScan: PS51450
IPR001611
766-788 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALRNLNLSWNHLSSRIPSSIGGL

HMMPfam: PF00560
IPR001611
767-788 LRR_1
Leucine-rich repeat

LRNLNLSWNHLSSRIPSSIGGL

ProfileScan: PS51450
IPR001611
790-813 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALESFDLSHNELSGEIPNSLSDLT

HMMPfam: PF00560
IPR001611
791-812 LRR_1
Leucine-rich repeat

LESFDLSHNELSGEIPNSLSDL

HMMPfam: PF00560
IPR001611
814-831 LRR_1
Leucine-rich repeat

SLVSLNLSYNDLTGQIPS

ProfileScan: PS51450
IPR001611
814-836 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVSLNLSYNDLTGQIPSGNQLR


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox