PRGDB00063822 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 239825521 (CM000762)
Gene Class Unknown
Domain Type LRR
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor chromosome 3, whole genome shotgun sequence.

DNA Sequence

TTTCAATAGACTTCAAGGAATCATACCAATACCAACAGTAAAAGTAGGATGTGAACTCATGAGTCTGAAACCGAGTGCTATCTTGCATTACTCAAATAATTACTTCAATGCCATTCCACCTAACTTTGGCGATTATCTCAAAGATATGACATATATCGACTTTTCGAATAACCTACTGAATGGTCATATACCAACTTCAGTTTGTAGTGCAAGAGACCTTGAAATCCTTGACTTATCCTACAACTACTTTAGCAGAATGATCCCAGCATGCTTAACACAAAATAACTTGAGAGTACTTAAGTTAAGAGGGAATCGAGTTCACGGGGAACTACCTGACAACATCCCAGCAGGATGTATGCTTCAGACAATAGATTTGAGCAGAAATTACATAACTGGAAAACTGCCGAGATCTCTGTCCAACTGCCAGGAATTAGAGCTACTTGATGTTGGTAACAATCAGATTACCGATTTATTTCCATCTTGGATGGGGGTTCTTCCAAAACTTAAAGTTCTGGTTTTGAGATCCAACCGATTATTTGGCATGATTACAGATCTTCAGGAGAATGAACAAATCATGGGCTATTTCTCAAGTTTGCAAATACTTTGTTTGGCCTCCAACAACTTCTCTGGGCACCTGCCAGAAGGATGGTTCAATGAACTGAAATCGATGATGTCAGATGATAATGAAGAGGGACAAGTTGTAGGGCATCAAATGAACACGTCACAAGGATTCTATCGGGATACTGTCACTATAACATTTAAGGGCTTGGATATTATTTTCACAAAAATACTAACCACTTTCAAAGCAATTGACTTCTCAAATAATTCATTCTATGGCCCGATACCAGCATCGATTGGGAGGCTTTCTTCACTGCACGGAATTAACATGTCTCACAATAATTTCACGGAGCAGATTCCATCACAGTTTGGTAATCTTACTTGTCTGGAATCGTTGGATCTATCATGGAATCATTTTTCAGGGGAAATCCCAGAGGAGTTAACCTCCCTTACTTCTCTTGCTTGGTTGAACCTTTCATACAACAACTTGACCGGAAGAATACCACAGGGCAACCAGTTTCTGTCGTTTCCCAACAGCTCTTTCGAAGGCAATCTTGGCCTCTGTGGAAGTCAAGTCTCTAAACAATGTGATAATTCAGGTTCAGGTTCAGCTACTCAAAGAGCATCAGATCATCATGAATCCAACAGTTTGTGGCAGGACAGAGTGGACACCATCCTTTTGTTCACATTTGTTGGTCTGGGGTTTGGAGTAGGTTTTGCATTGGCAATGATGTTCAACCGCTTTTGCCACATAGAAGGATGGGTTTGCAAGCACTATGGAACCCATACATAAGCAAAATTCCAAGAAGCTTGTTCACACTTCCAAAATTGCAATCACTTTCTCTCTCATCAAATCAACTTTCTGGCCATTTAGATGCCATTGACAACCCTTTGTCTTCACTCTTGTCTAATGTAAATTTGGTAGATAACAACAATGGGGGATCTATACCTCAGTCTTACACTCAGCTTCCAAGTCTTGAAGCACTTTACCTTGACTCAAATAAATTGACGGGCACAGTGAACCTAAGATCTTTCTGGAGGCTCAAGAATCTTTATGCATTGAGTCTTTCTAACAACATGCTGACAGTGATAGATGAAGAAGATGATCCTCTCCTTTCTTCATTACCTCACATCAAGATTTTGGAGCTAGCATCTTGCAACCTTAGAAAACTTCCACGAACTTTGAGATTTCTAGATGGCATTGAGACACTTGACCTCTCAAACAATCATATTCATGGGGCAATACCAGGCTGGCTGTGGGAGACCCGGACTGGCTGCATGAGCTATTTAAATCTCTCGCACAACATCAGCAGCAACACTGCCGGCGCCGGGTCATCATCATGCTCTCCGGCCGACGCTGCCGCGCTGCTCCAGCTAAAGCAATCCTTCGTCGACCCCAAGGACCTCACGTCATGGCGAGCCAAGACGGACTGCTGCCTCTGGGAAGCCGTCGCCTGTGACGCTGACGCGACCTCAGGCCCAGGGCGGGTGATCGCGTTGGATCTAGGAGGCCGGAACCTGCGGAGCCGCCGGGGCCTTCACCCCGCGCTCTTCGACCTCACCTCTCTGAGGAACCTCAGCCTCCGGGGCAACGACTTCATGGGGGCGACCCTGCCGTCCGCTGGGTTCGAGCTGCTCAGCGAGATGGTCCACCTCGACATGGCCGACGCAAATTTCAGCGGCCAGATCCCCATCGGCGTAGCGCGGCTCAGCAAGCTGGTCCATCTCTCTGCCGGGGCCGGGGCCGGGGGCCCCAGCAGCAGGCTGGTCCTCAAGGAGCCAAGCTTTGAAACACTGGTCGCTAATCTCGGCAATCTAAGAGAGCTTCGCCTTCGTGGAGTGGACATCTCCATCGGCGGCAGAGAGACGTGGTCCGTTGCTCTAGCAAGATCCACACCGGACCTGCAGATTCTGTCTCTGTCCTCCTGTGGCCTGTCTGGACCCATCCATGGCTCCTTCTCACGGCTTCGCTCGCTGGCCGAGATCAGCCTCCCTGGCAACAGAATCGCTGGCAAGGTTCCTGAGTTTTTTGCTGGCTTCTCTTCCTTGAGCACCCTTGACCTGAGAGACAATGACTTTGAAGGGCAGTTTCCGGCAGAGGTCTTTCGACTGAAAAATCTGAAGGTCCTTTTGGTGTCCGGGAATTCAAGGCTTTCTGGGCATCTGGAAAGCTTTCCAGTGGAAAACAGACTAGAAATGCTTGACCTGAAGGACACAAACTTTTCTGATGCCTTGCCGGCATCCATCGTCAATCTCAAGTCTTTGAGATTTTTGACTCTTTCCACAGGAGGAACTTCCAAGCACCTTCACTTTATAGGCAAGCTTCCATCTTTGGGCACGTTAATGCTCCAGGGATCATCATCAGGATTAGGGAAGGCACAGTTCTCTTGGATTGGGGATCTCACACATTTGACAAGTTTGTTGATTGACAACTACAACTTCTCTGAACCAATACCATCCTGGATCGGCAATCTTACAGAACTGATGTCACTAAGGCTCAGCATGTGCAGCTTATATGGACCGATACCTTACTGGATTGGTAACTTGACGCAGCTTTCAAGCATAGACTTCACCGGGAATTATCTCACTGATGAGTTCCAGGCACTCAAAGCTCCACGTCTTCCTGCACCTCCTCTTATACTTCTGCATCATCGTCCGCACTGAAAATAT


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein SORBIDRAFT_03g005070 [Sorghum bicolor].

MSSRHSKLHVFLHLLLYFCIIVRTENISSNTAGAGSSSCSPADAAALLQLKQSFVDPKDLTSWRAKTDCCLWEAVACDADATSGPGRVIALDLGGRNLRSRRGLHPALFDLTSLRNLSLRGNDFMGATLPSAGFELLSEMVHLDMADANFSGQIPIGVARLSKLVHLSAGAGAGGPSSRLVLKEPSFETLVANLGNLRELRLRGVDISIGGRETWSVALARSTPDLQILSLSSCGLSGPIHGSFSRLRSLAEISLPGNRIAGKVPEFFAGFSSLSTLDLRDNDFEGQFPAEVFRLKNLKVLLVSGNSRLSGHLESFPVENRLEMLDLKDTNFSDALPASIVNLKSLRFLTLSTGGTSKHLHFIGKLPSLGTLMLQGSSSGLGKAQFSWIGDLTHLTSLLIDNYNFSEPIPSWIGNLTELMSLRLSMCSLYGPIPYWIGNLTQLSSIDFTGNYLTGKIPRSLFTLPKLQSLSLSSNQLSGHLDAIDNPLSSLLSNVNLVDNNNGGSIPQSYTQLPSLEALYLDSNKLTGTVNLRSFWRLKNLYALSLSNNMLTVIDEEDDPLLSSLPHIKILELASCNLRKLPRTLRFLDGIETLDLSNNHIHGAIPGWLWETRTGCMSYLNLSHNIFNRLQGIIPIPTVKVGCELMSLKPSAILHYSNNYFNAIPPNFGDYLKDMTYIDFSNNLLNGHIPTSVCSARDLEILDLSYNYFSRMIPACLTQNNLRVLKLRGNRVHGELPDNIPAGCMLQTIDLSRNYITGKLPRSLSNCQELELLDVGNNQITDLFPSWMGVLPKLKVLVLRSNRLFGMITDLQENEQIMGYFSSLQILCLASNNFSGHLPEGWFNELKSMMSDDNEEGQVVGHQMNTSQGFYRDTVTITFKGLDIIFTKILTTFKAIDFSNNSFYGPIPASIGRLSSLHGINMSHNNFTEQIPSQFGNLTCLESLDLSWNHFSGEIPEELTSLTSLAWLNLSYNNLTGRIPQGNQFLSFPNSSFEGNLGLCGSQVSKQCDNSGSGSATQRASDHHESNSLWQDRVDTILLFTFVGLGFGVGFALAMMFNRFCHIEGWVCKHYGTHT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF905
2-996 PTHR24420:SF905

SSRHSKLHVFLHLLLYFCIIVRTENISSNTAGAGSSSCSPADAAALLQLKQSFVDPKDLTSWRAKTDCCLWEAVACDADATSGPGRVIALDLGGRNLRSRRGLHPALFDLTSLRNLSLRGNDFMGATLPSAGFELLSEMVHLDMADANFSGQIPIGVARLSKLVHLSAGAGAGGPSSRLVLKEPSFETLVANLGNLRELRLRGVDISIGGRETWSVALARSTPDLQILSLSSCGLSGPIHGSFSRLRSLAEISLPGNRIAGKVPEFFAGFSSLSTLDLRDNDFEGQFPAEVFRLKNLKVLLVSGNSRLSGHLESFPVENRLEMLDLKDTNFSDALPASIVNLKSLRFLTLSTGGTSKHLHFIGKLPSLGTLMLQGSSSGLGKAQFSWIGDLTHLTSLLIDNYNFSEPIPSWIGNLTELMSLRLSMCSLYGPIPYWIGNLTQLSSIDFTGNYLTGKIPRSLFTLPKLQSLSLSSNQLSGHLDAIDNPLSSLLSNVNLVDNNNGGSIPQSYTQLPSLEALYLDSNKLTGTVNLRSFWRLKNLYALSLSNNMLTVIDEEDDPLLSSLPHIKILELASCNLRKLPRTLRFLDGIETLDLSNNHIHGAIPGWLWETRTGCMSYLNLSHNIFNRLQGIIPIPTVKVGCELMSLKPSAILHYSNNYFNAIPPNFGDYLKDMTYIDFSNNLLNGHIPTSVCSARDLEILDLSYNYFSRMIPACLTQNNLRVLKLRGNRVHGELPDNIPAGCMLQTIDLSRNYITGKLPRSLSNCQELELLDVGNNQITDLFPSWMGVLPKLKVLVLRSNRLFGMITDLQENEQIMGYFSSLQILCLASNNFSGHLPEGWFNELKSMMSDDNEEGQVVGHQMNTSQGFYRDTVTITFKGLDIIFTKILTTFKAIDFSNNSFYGPIPASIGRLSSLHGINMSHNNFTEQIPSQFGNLTCLESLDLSWNHFSGEIPEELTSLTSLAWLNLSYNNLTGRIPQGNQFLSFPNSSFEGN

HMMPanther: PTHR24420
2-996 PTHR24420,FAMILY NOT NAMED

SSRHSKLHVFLHLLLYFCIIVRTENISSNTAGAGSSSCSPADAAALLQLKQSFVDPKDLTSWRAKTDCCLWEAVACDADATSGPGRVIALDLGGRNLRSRRGLHPALFDLTSLRNLSLRGNDFMGATLPSAGFELLSEMVHLDMADANFSGQIPIGVARLSKLVHLSAGAGAGGPSSRLVLKEPSFETLVANLGNLRELRLRGVDISIGGRETWSVALARSTPDLQILSLSSCGLSGPIHGSFSRLRSLAEISLPGNRIAGKVPEFFAGFSSLSTLDLRDNDFEGQFPAEVFRLKNLKVLLVSGNSRLSGHLESFPVENRLEMLDLKDTNFSDALPASIVNLKSLRFLTLSTGGTSKHLHFIGKLPSLGTLMLQGSSSGLGKAQFSWIGDLTHLTSLLIDNYNFSEPIPSWIGNLTELMSLRLSMCSLYGPIPYWIGNLTQLSSIDFTGNYLTGKIPRSLFTLPKLQSLSLSSNQLSGHLDAIDNPLSSLLSNVNLVDNNNGGSIPQSYTQLPSLEALYLDSNKLTGTVNLRSFWRLKNLYALSLSNNMLTVIDEEDDPLLSSLPHIKILELASCNLRKLPRTLRFLDGIETLDLSNNHIHGAIPGWLWETRTGCMSYLNLSHNIFNRLQGIIPIPTVKVGCELMSLKPSAILHYSNNYFNAIPPNFGDYLKDMTYIDFSNNLLNGHIPTSVCSARDLEILDLSYNYFSRMIPACLTQNNLRVLKLRGNRVHGELPDNIPAGCMLQTIDLSRNYITGKLPRSLSNCQELELLDVGNNQITDLFPSWMGVLPKLKVLVLRSNRLFGMITDLQENEQIMGYFSSLQILCLASNNFSGHLPEGWFNELKSMMSDDNEEGQVVGHQMNTSQGFYRDTVTITFKGLDIIFTKILTTFKAIDFSNNSFYGPIPASIGRLSSLHGINMSHNNFTEQIPSQFGNLTCLESLDLSWNHFSGEIPEELTSLTSLAWLNLSYNNLTGRIPQGNQFLSFPNSSFEGN

Gene3D: G3DSA:3.80.10.10
39-156 G3DSA:3.80.10.10

CSPADAAALLQLKQSFVDPKDLTSWRAKTDCCLWEAVACDADATSGPGRVIALDLGGRNLRSRRGLHPALFDLTSLRNLSLRGNDFMGATLPSAGFELLSEMVHLDMADANFSGQIPI

HMMPfam: PF08263
IPR013210
41-78 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PADAAALLQLKQSFVDPKDLTSWRAKTDCCLWEAVACD

superfamily: SSF52047
90-406 SSF52047,LRR

ALDLGGRNLRSRRGLHPALFDLTSLRNLSLRGNDFMGATLPSAGFELLSEMVHLDMADANFSGQIPIGVARLSKLVHLSAGAGAGGPSSRLVLKEPSFETLVANLGNLRELRLRGVDISIGGRETWSVALARSTPDLQILSLSSCGLSGPIHGSFSRLRSLAEISLPGNRIAGKVPEFFAGFSSLSTLDLRDNDFEGQFPAEVFRLKNLKVLLVSGNSRLSGHLESFPVENRLEMLDLKDTNFSDALPASIVNLKSLRFLTLSTGGTSKHLHFIGKLPSLGTLMLQGSSSGLGKAQFSWIGDLTHLTSLLIDNYNFS

Gene3D: G3DSA:3.80.10.10
190-370 G3DSA:3.80.10.10

LVANLGNLRELRLRGVDISIGGRETWSVALARSTPDLQILSLSSCGLSGPIHGSFSRLRSLAEISLPGNRIAGKVPEFFAGFSSLSTLDLRDNDFEGQFPAEVFRLKNLKVLLVSGNSRLSGHLESFPVENRLEMLDLKDTNFSDALPASIVNLKSLRFLTLSTGGTSKHLHFIGKLPSLG

HMMPfam: PF13855
225-283 LRR_8,Leucine rich repeat

DLQILSLSSCGLSGPIHGSFSRLRSLAEISLPGNRIAGKVPEFFAGFSSLSTLDLRDND

Gene3D: G3DSA:3.80.10.10
371-627 G3DSA:3.80.10.10

TLMLQGSSSGLGKAQFSWIGDLTHLTSLLIDNYNFSEPIPSWIGNLTELMSLRLSMCSLYGPIPYWIGNLTQLSSIDFTGNYLTGKIPRSLFTLPKLQSLSLSSNQLSGHLDAIDNPLSSLLSNVNLVDNNNGGSIPQSYTQLPSLEALYLDSNKLTGTVNLRSFWRLKNLYALSLSNNMLTVIDEEDDPLLSSLPHIKILELASCNLRKLPRTLRFLDGIETLDLSNNHIHGAIPGWLWETRTGCMSYLNLSHNIF

superfamily: SSF52058
377-625 SSF52058,LRR

SSSGLGKAQFSWIGDLTHLTSLLIDNYNFSEPIPSWIGNLTELMSLRLSMCSLYGPIPYWIGNLTQLSSIDFTGNYLTGKIPRSLFTLPKLQSLSLSSNQLSGHLDAIDNPLSSLLSNVNLVDNNNGGSIPQSYTQLPSLEALYLDSNKLTGTVNLRSFWRLKNLYALSLSNNMLTVIDEEDDPLLSSLPHIKILELASCNLRKLPRTLRFLDGIETLDLSNNHIHGAIPGWLWETRTGCMSYLNLSHN

HMMPfam: PF13855
418-477 LRR_8,Leucine rich repeat

ELMSLRLSMCSLYGPIPYWIGNLTQLSSIDFTGNYLTGKIPRSLFTLPKLQSLSLSSNQL

HMMPfam: PF13855
491-551 LRR_8,Leucine rich repeat

LLSNVNLVDNNNGGSIPQSYTQLPSLEALYLDSNKLTGTVNLRSFWRLKNLYALSLSNNML

HMMPfam: PF13855
566-625 LRR_8,Leucine rich repeat

PHIKILELASCNLRKLPRTLRFLDGIETLDLSNNHIHGAIPGWLWETRTGCMSYLNLSHN

superfamily: SSF52058
640-996 SSF52058,LRR

KVGCELMSLKPSAILHYSNNYFNAIPPNFGDYLKDMTYIDFSNNLLNGHIPTSVCSARDLEILDLSYNYFSRMIPACLTQNNLRVLKLRGNRVHGELPDNIPAGCMLQTIDLSRNYITGKLPRSLSNCQELELLDVGNNQITDLFPSWMGVLPKLKVLVLRSNRLFGMITDLQENEQIMGYFSSLQILCLASNNFSGHLPEGWFNELKSMMSDDNEEGQVVGHQMNTSQGFYRDTVTITFKGLDIIFTKILTTFKAIDFSNNSFYGPIPASIGRLSSLHGINMSHNNFTEQIPSQFGNLTCLESLDLSWNHFSGEIPEELTSLTSLAWLNLSYNNLTGRIPQGNQFLSFPNSSFEGN

Gene3D: G3DSA:3.80.10.10
648-729 G3DSA:3.80.10.10

LKPSAILHYSNNYFNAIPPNFGDYLKDMTYIDFSNNLLNGHIPTSVCSARDLEILDLSYNYFSRMIPACLTQNNLRVLKLRG

Gene3D: G3DSA:3.80.10.10
730-851 G3DSA:3.80.10.10

NRVHGELPDNIPAGCMLQTIDLSRNYITGKLPRSLSNCQELELLDVGNNQITDLFPSWMGVLPKLKVLVLRSNRLFGMITDLQENEQIMGYFSSLQILCLASNNFSGHLPEGWFNELKSMMS

HMMPfam: PF13855
746-804 LRR_8,Leucine rich repeat

LQTIDLSRNYITGKLPRSLSNCQELELLDVGNNQITDLFPSWMGVLPKLKVLVLRSNRL

Gene3D: G3DSA:3.80.10.10
896-1002 G3DSA:3.80.10.10

IDFSNNSFYGPIPASIGRLSSLHGINMSHNNFTEQIPSQFGNLTCLESLDLSWNHFSGEIPEELTSLTSLAWLNLSYNNLTGRIPQGNQFLSFPNSSFEGNLGLCGS

HMMPfam: PF00560
IPR001611
917-938 LRR_1
Leucine-rich repeat

LHGINMSHNNFTEQIPSQFGNL

HMMPfam: PF12799
940-976 LRR_4,Leucine Rich repeats (2 copies)

CLESLDLSWNHFSGEIPEELTSLTSLAWLNLSYNNLT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox