PRGDB00063839 (unknown)

From PRG Wiki
Jump to: navigation, search
unknown
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 238005943 (BT083654)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0025H23 mRNA, complete cds.

DNA Sequence

ATGCTCAGCTCGTCGGCGTCCAGGAGGGACGCCGCGAGGAGCGGCGCGGAGCTCCCTCGGCCGCACGCGGTGGCAGGGATGGCGCGGAGCGGGGAGCTGCCCAAGGGCGCCCCCTCCGCGACGGCCCCTGATGCGGTGCGGTGCGAGGGATGGATGGTGCGCCACGGCCGGAGGAAGATCGGGAGGTCCTTCTTCCACACGCGCTACTTCGTCCTCGACAACGGCGTGCTCGCGTACTACAAGAAGAAGCCGAGGGACCACATGATCCCACTCAAGTCAATTATTATTGATGGAAATTGCAGAGTGGAGGATAGAGGGCTTAAAACACATCATGGTCAAATGATTTATTTGCTATGCATTTACAACAAGAAAGAAAAGGAGAACCAAATCACGATGGGTGGATACGATATTGAAGATGCCCTAGCCTGGAAGAGGAAGATAGAGCTTCTGATTGATCAGCAACAGGATACTACGACAGCTAAAAACCATAAAGCTTTTGCTTCGTTGGACTTTGATATAGATCTTGGAGGACCATTTTCGTTCTCTGACCATGACAGCGGACCCGAAGATGAAGAAGAGCCCCGACCCACCTTGCTTCGCAGGACAACTATAGGGAATGGCCCTCCTGATTCTGTACTTGATTGGACCAAAGAGGCTGACAGTGGGCTGTCAAATCAGAATGCCACCAGTCAGGCTTACTCCAGAAAGAACTGGAGGCTTCTTAGATGCCAGAATGGATTGCGCATCTTTGAAGAACTTGTGGAGGTTGAATACCTTGCAAGAAGCTATAGTCGAGCAATGAGGGCTGTAGGAGTGGTGGAAGCCTCATGCGAGGCCATTTTTGGGCTTGTAATGAGCATGGATGCATCACGATATGAATGGGATTGTAGCTTCCAATATGGGAGTTTAGTTGAAGAGGTCGATGGTCATACTGCAATACTGTACCATCGTCTACAACTGAACTGGTTTTCAATGTTGGTCTGGCCACGAGATCTTTGTTATGTACGCTATTGGCGGCGCAACGATGATGGAAGCTATGTTGTGCTGTTTCGATCTACCGAAAATCAGAACTGTGGGCCTCAACCAGGATTTGTGAGAGCTTCTATCGAAAGTGGAGGTTTCAAGATTTCCCCTCTCAAAAGCCTCAATGGGAGGCCCCGCACTCAAGTTCAACACCTTATGCAGATTGATGTTAGGGGATGGGGCGTGAACTATTTACCATCATTCCAGTACTACTCTTTGCTGCAGATGCTGAACTGTGTTGCTGGATTGCGTGAATATTTTTCGCAAACAGATGAAATTCATACAGTTCCAAGGATTCCGGTGATGCATACCATGGTTAATGCGGCCTCAATGAAAAAGGACCAAAACCTTCAAGAACCAGACTCGAAGACCAAACAAGCTGATAACAAACATTTGGATATGGTAGATGAAGAGTCGGAAGATGATGATGACTATCAAGTTCCTGATGCTGATGTGGAGGAAGAACCTACCAAATCTGACAGTGATGCTAAGAACTCAGACCCAATAGATTTGTCTTGGTTTTCGGGCATTATTCGTCAGGATACAAATGAGAAAAGTCGTAACTGTTGGGCAGTGCCTGATAGCAAGATCTTTAAAGTTCGTAGCAAGAACTTTCCACATGACAAATCAAAGGTACCAGCAGGTAAGTATCTAATGGAGCTCGTAGCAGTTGACTGGTTTAAGGACGCCAAGCGCATGGATCATGTCGCTAGGCGGAAAGGATCTGCGGTTCAGGTTGCCGCTGAGAAGGGAATGTTCACTTTCCTGGTAAACATACAAATTCCTGGACCAAGTCATTACAGCTTGGTCCTTTATTTTGTCTCAAACTCCTTGAAGAAAGGATCGCTGTTGCAGCGTTTTGCCGATGGTGATGATGATTTTAGAAACAGCAGACTGAAGCTTATCCCATCTGTTCCAAAGGGGTCTTGGATAGTGCGGCAAAGTGTTGGAAGCACACCTTGCTTGCTGGGGAAAGCCGTGGACTGCAGCTATTTGCGTGGTCCTGACTACTTAGAAGTGGATGTAGATATCGGTTCGTCCGCGGTAGCCAACGGGGTCCTGGGCTTGGTGTTTGGCGTTGTTACCACCTTGGTAGTCGACATGGCGTTTCTTATACAGGCAAACACGTACGACGAGCTCCCAGAGCAGCTCCTAGGCGCTGCGCGGCTGTCACACATCGAACCTTCTGCGGCCGTGTATCCTGTCCTTGACAACATTTCCTGA


Protein sequences

Name Description Sequence
unknown unknown [Zea mays].

MLSSSASRRDAARSGAELPRPHAVAGMARSGELPKGAPSATAPDAVRCEGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKPRDHMIPLKSIIIDGNCRVEDRGLKTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQQQDTTTAKNHKAFASLDFDIDLGGPFSFSDHDSGPEDEEEPRPTLLRRTTIGNGPPDSVLDWTKEADSGLSNQNATSQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYYSLLQMLNCVAGLREYFSQTDEIHTVPRIPVMHTMVNAASMKKDQNLQEPDSKTKQADNKHLDMVDEESEDDDDYQVPDADVEEEPTKSDSDAKNSDPIDLSWFSGIIRQDTNEKSRNCWAVPDSKIFKVRSKNFPHDKSKVPAGKYLMELVAVDWFKDAKRMDHVARRKGSAVQVAAEKGMFTFLVNIQIPGPSHYSLVLYFVSNSLKKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYLRGPDYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYDELPEQLLGAARLSHIEPSAAVYPVLDNIS

Domains

Domain Start-End Description Sequence

superfamily: SSF50729
41-160 SSF50729

TAPDAVRCEGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKPRDHMIPLKSIIIDGNCRVEDRGLKTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQQQDTTTA

Gene3D: G3DSA:2.30.29.30
IPR011993
43-159 PH_type
Pleckstrin homology-like domain

PDAVRCEGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKPRDHMIPLKSIIIDGNCRVEDRGLKTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQQQDTTT

ProfileScan: PS50003
IPR001849
45-152 PH_DOMAIN
Pleckstrin homology domain

AVRCEGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKPRDHMIPLKSIIIDGNCRVEDRGLKTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLID

HMMPanther: PTHR12136
46-443 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

VRCEGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKPRDHMIPLKSIIIDGNCRVEDRGLKTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQQQDTTTAKNHKAFASLDFDIDLGGPFSFSDHDSGPEDEEEPRPTLLRRTTIGNGPPDSVLDWTKEADSGLSNQNATSQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYYSLLQMLNCVAGLREYFSQTDEIHTVPRIPVM

HMMSmart: SM00233
IPR001849
46-154 PH
Pleckstrin homology domain

VRCEGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKPRDHMIPLKSIIIDGNCRVEDRGLKTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQQ

HMMPanther: PTHR12136:SF13
46-443 PTHR12136:SF13,SUBFAMILY NOT NAMED

VRCEGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKPRDHMIPLKSIIIDGNCRVEDRGLKTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQQQDTTTAKNHKAFASLDFDIDLGGPFSFSDHDSGPEDEEEPRPTLLRRTTIGNGPPDSVLDWTKEADSGLSNQNATSQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYYSLLQMLNCVAGLREYFSQTDEIHTVPRIPVM

HMMSmart: SM00234
IPR002913
218-430 START
Lipid-binding START

EADSGLSNQNATSQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYYSLLQMLNCVAGLREYFSQ

Gene3D: G3DSA:3.30.530.20
IPR023393
228-432 G3DSA:3.30.530.20
START-like domain

ATSQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYYSLLQMLNCVAGLREYFSQTD

superfamily: SSF55961
234-433 SSF55961

SRKNWRLLRCQNGLRIFEELVEVEYLARSYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYYSLLQMLNCVAGLREYFSQTDE

ProfileScan: PS50848
IPR002913
238-412 START
Lipid-binding START

WRLLRCQNGLRIFEELVEVEYLARSYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYY

HMMPfam: PF01852
IPR002913
262-405 START
Lipid-binding START

SYSRAMRAVGVVEASCEAIFGLVMSMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNY

HMMPfam: PF07059
IPR009769
531-735 DUF1336
Domain of unknown function DUF1336

WAVPDSKIFKVRSKNFPHDKSKVPAGKYLMELVAVDWFKDAKRMDHVARRKGSAVQVAAEKGMFTFLVNIQIPGPSHYSLVLYFVSNSLKKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYLRGPDYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYDELPEQLLGAARLSHIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox