PRGDB00063845 (wheat kinase-START domain protein splice variant WKS1.5)

From PRG Wiki
Jump to: navigation, search
wheat kinase-START domain protein splice variant WKS1.5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 194131658 (EU835199)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum turgidum subsp. dicoccoides

Comment?

Triticum turgidum subsp. dicoccoides wheat kinase-START domain protein (WKS1) gene, complete cds, alternatively spliced.

DNA Sequence

ATGGAGCTCCCACGAAACAAACTTGCAGATTTGAACCAAGGAAATGAAAATTTAAAGGCAAAGGCAAAGTGGACACCCAATGCCAGGAGGTTCACAGAACATCAGATTAAAAGAATTACTAAGAACTATAGAACTCATGTTGGCAAAGGTGCCTTTGGTGAGGTTTTCCGAGGTTTTCTTGACGATGGCAGTCCAGTTGCAGTGAAGAAGTACATGAACCAGAATATGAAAGAAGGGTTTGACAAAGAGATAACTATCCATTGCCAAGTCAACCACAAGAACATAGTCAAGCTTTTGGGTTATTGTTCAGAGGAAAATGCCTTGACGATGGTCACTGAGTACATTCCCAGAGGAAACCTCAAAGACCTCCTTCATGGAAGTGATGATCCCATTTCTTTTGAGGCAAGATTGCGTATTGCTATAGATTGTGCAGATGCATTAGCCTTCATGCATTCAAAGGATCCGCCAATCATTCACGGTGACATCAAACCTGACAATATACTCTTGGATGATAACTTGGGTGCAAAATTATCTGACTTTGGAATATCAAGGTTGCTTTCTATGGAGAATAGTTATTTTACTAATAATGTAATAGGAAGCAGAGGTTACATGGATCCAGAACACATTCAGACTGGCCGGGTTGATCCTAAGAATGATGTTTACAGTTTTGGGGTTGTTTTGGTAGAACTAGTTACCAGAGCTATGGCAGCTCAGAATGGGACATGTAACGACCTTGCAAAGAAATTCATTGAAGCTTTCCTCCAAAAAAATATTTTTTTGAAAGTTTTTGGAAAGCAAAAAAAGGCAAGAAGAGAGATGTTTGATACCCAGATAGCAAATGCGAGCAACATGGAGGTTCTAGAAAAAATTGGAGAGCTGGCAATTGAGTGTCTCAGAAGGGATATCAAGAAACGTCCTGAAATGAATCATGTTGTAGAACGTCTTCGAATGCTTGGTAAAGATCACGAAAAAAGACAAGATAGAAAGCCAGAAAAGCAACATGGAGTGGTGCCTCCTGATGGTAATACAACCTTTAGCTCTTCGTGGCCAAAGGGTAGATTAGAAAATGGAAGGAAATCTTCTTCCTCTGATGCCAAGAGTCTGTTCAGTCATAGGGGGGTGGAAGCAGTAGACGAAGAAAATCAACATCCATTATTGCGAAGAACGTCAATTGGAAATGGTCCTCCAGGATCATTTCATGATTGGACCTGTGGGAACGACATAGGAGGCCCTGACGAAGTATTCTCTGGAGGACACTGGCGTCTTCTCGGATGCCAGAATGGCCTCCACATTTTTGAGGCGCTCGAGGATGTTGATTACCTTGTAAGAGCCGTTGGCAAAGCAATGAAGGCCGTTGGTGTGATTGAGGCACCCTGCGAGGCTATATTTCAGCTTCTCATGAGCATGGACAGTAGCCGTTATGAGTGGGACTGCAGCTTCTCGTATGGTAGTCTAGTGGAGGAGGTTTGTTTGGCCTCGTGA


Protein sequences

Name Description Sequence
wheat kinase-START domain protein splice variant WKS1.5 wheat kinase-START domain protein splice variant WKS1.5 [Triticum turgidum subsp. dicoccoides].

MELPRNKLADLNQGNENLKAKAKWTPNARRFTEHQIKRITKNYRTHVGKGAFGEVFRGFLDDGSPVAVKKYMNQNMKEGFDKEITIHCQVNHKNIVKLLGYCSEENALTMVTEYIPRGNLKDLLHGSDDPISFEARLRIAIDCADALAFMHSKDPPIIHGDIKPDNILLDDNLGAKLSDFGISRLLSMENSYFTNNVIGSRGYMDPEHIQTGRVDPKNDVYSFGVVLVELVTRAMAAQNGTCNDLAKKFIEAFLQKNIFLKVFGKQKKARREMFDTQIANASNMEVLEKIGELAIECLRRDIKKRPEMNHVVERLRMLGKDHEKRQDRKPEKQHGVVPPDGNTTFSSSWPKGRLENGRKSSSSDAKSLFSHRGVEAVDEENQHPLLRRTSIGNGPPGSFHDWTCGNDIGGPDEVFSGGHWRLLGCQNGLHIFEALEDVDYLVRAVGKAMKAVGVIEAPCEAIFQLLMSMDSSRYEWDCSFSYGSLVEEVCLAS

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
13-323 Kinase_like
Protein kinase-like domain

QGNENLKAKAKWTPNARRFTEHQIKRITKNYRTHVGKGAFGEVFRGFLDDGSPVAVKKYMNQNMKEGFDKEITIHCQVNHKNIVKLLGYCSEENALTMVTEYIPRGNLKDLLHGSDDPISFEARLRIAIDCADALAFMHSKDPPIIHGDIKPDNILLDDNLGAKLSDFGISRLLSMENSYFTNNVIGSRGYMDPEHIQTGRVDPKNDVYSFGVVLVELVTRAMAAQNGTCNDLAKKFIEAFLQKNIFLKVFGKQKKARREMFDTQIANASNMEVLEKIGELAIECLRRDIKKRPEMNHVVERLRMLGKDHE

Gene3D: G3DSA:3.30.200.20
25-101 G3DSA:3.30.200.20

TPNARRFTEHQIKRITKNYRTHVGKGAFGEVFRGFLDDGSPVAVKKYMNQNMKEGFDKEITIHCQVNHKNIVKLLGY

HMMPanther: PTHR24420:SF444
27-400 PTHR24420:SF444,SUBFAMILY NOT NAMED

NARRFTEHQIKRITKNYRTHVGKGAFGEVFRGFLDDGSPVAVKKYMNQNMKEGFDKEITIHCQVNHKNIVKLLGYCSEENALTMVTEYIPRGNLKDLLHGSDDPISFEARLRIAIDCADALAFMHSKDPPIIHGDIKPDNILLDDNLGAKLSDFGISRLLSMENSYFTNNVIGSRGYMDPEHIQTGRVDPKNDVYSFGVVLVELVTRAMAAQNGTCNDLAKKFIEAFLQKNIFLKVFGKQKKARREMFDTQIANASNMEVLEKIGELAIECLRRDIKKRPEMNHVVERLRMLGKDHEKRQDRKPEKQHGVVPPDGNTTFSSSWPKGRLENGRKSSSSDAKSLFSHRGVEAVDEENQHPLLRRTSIGNGPPGSFH

HMMPanther: PTHR24420
27-400 PTHR24420,FAMILY NOT NAMED

NARRFTEHQIKRITKNYRTHVGKGAFGEVFRGFLDDGSPVAVKKYMNQNMKEGFDKEITIHCQVNHKNIVKLLGYCSEENALTMVTEYIPRGNLKDLLHGSDDPISFEARLRIAIDCADALAFMHSKDPPIIHGDIKPDNILLDDNLGAKLSDFGISRLLSMENSYFTNNVIGSRGYMDPEHIQTGRVDPKNDVYSFGVVLVELVTRAMAAQNGTCNDLAKKFIEAFLQKNIFLKVFGKQKKARREMFDTQIANASNMEVLEKIGELAIECLRRDIKKRPEMNHVVERLRMLGKDHEKRQDRKPEKQHGVVPPDGNTTFSSSWPKGRLENGRKSSSSDAKSLFSHRGVEAVDEENQHPLLRRTSIGNGPPGSFH

ProfileScan: PS50011
IPR000719
41-318 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KNYRTHVGKGAFGEVFRGFLDDGSPVAVKKYMNQNMKEGFDKEITIHCQVNHKNIVKLLGYCSEENALTMVTEYIPRGNLKDLLHGSDDPISFEARLRIAIDCADALAFMHSKDPPIIHGDIKPDNILLDDNLGAKLSDFGISRLLSMENSYFTNNVIGSRGYMDPEHIQTGRVDPKNDVYSFGVVLVELVTRAMAAQNGTCNDLAKKFIEAFLQKNIFLKVFGKQKKARREMFDTQIANASNMEVLEKIGELAIECLRRDIKKRPEMNHVVERLRML

HMMPfam: PF00069
IPR000719
45-313 Pkinase,Ser-thr
Protein kinase, catalytic domain

THVGKGAFGEVFRGFLDDGSPVAVKKYMNQNMKEGFDKEITIHCQVNHKNIVKLLGYCSEENALTMVTEYIPRGNLKDLLHGSDDPISFEARLRIAIDCADALAFMHSKDPPIIHGDIKPDNILLDDNLGAKLSDFGISRLLSMENSYFTNNVIGSRGYMDPEHIQTGRVDPKNDVYSFGVVLVELVTRAMAAQNGTCNDLAKKFIEAFLQKNIFLKVFGKQKKARREMFDTQIANASNMEVLEKIGELAIECLRRDIKKRPEMNHVVE

PatternScan: PS00107
IPR017441
47-70 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGAFGEVFRGFLDDGSPVAVKK

Gene3D: G3DSA:1.10.510.10
102-332 G3DSA:1.10.510.10

CSEENALTMVTEYIPRGNLKDLLHGSDDPISFEARLRIAIDCADALAFMHSKDPPIIHGDIKPDNILLDDNLGAKLSDFGISRLLSMENSYFTNNVIGSRGYMDPEHIQTGRVDPKNDVYSFGVVLVELVTRAMAAQNGTCNDLAKKFIEAFLQKNIFLKVFGKQKKARREMFDTQIANASNMEVLEKIGELAIECLRRDIKKRPEMNHVVERLRMLGKDHEKRQDRKPEK

PatternScan: PS00108
IPR008271
157-169 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHGDIKPDNILL

superfamily: SSF55961
416-489 SSF55961

SGGHWRLLGCQNGLHIFEALEDVDYLVRAVGKAMKAVGVIEAPCEAIFQLLMSMDSSRYEWDCSFSYGSLVEEV

Gene3D: G3DSA:3.30.530.20
IPR023393
419-489 G3DSA:3.30.530.20
START-like domain

HWRLLGCQNGLHIFEALEDVDYLVRAVGKAMKAVGVIEAPCEAIFQLLMSMDSSRYEWDCSFSYGSLVEEV


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox