PRGDB00063850 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 225462999 (XM_002264536)
Gene Class Unknown
Domain Type
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100260203 (LOC100260203), mRNA.

DNA Sequence

ATGGCAGCAACGTCAGCGCCGCTCTCCAAGCCCGGTAGCCAGGGATCGTCGGAGAGATACGGATCGGAGAGCGGCGCGGAGGAGAAGGCCCAGCGTGCGACTTTCGAGTATTTTGGATGGGTTTATCATCTGGGGGTCAATTCTATTGGGCGTGAGTACTGCCATCTTCGTTTCTTGTTTGTCAGGGGCAAGTATATGGAGATGTACAAGCGCGATCCCCACCAGTTTCCCGGCATTAAACCGATTAGGAGGGGTGTTGTAGGATATACACTCACAGTAGAGGAGCTTGGACGGCGGAAGCTCAACGGTGGGGATATTTATGTTCTGCGCTTGTACAACCGGTTGGATGAGACAAGAAAGGGTGAAATTGCTTGTGCTTCAGCTGGAGAAGCTCGAAAATGGATGGAAGCATTTGATCATGCCAAGCAACAGGCTGAATACGAGCTGTCAAGAGGAAGTGGTGCCAGAAATAAACTGAACATGGAAACTGAGATCAATCTTGAAGGGCATCGACATTCTGTGCGGCGGTATGCACATGGTTTGAAAGAGCTTATAAAAATTGGACAAGGCCCTGAGTCACTTTTGCGACAATCCTCAAACTTGGGTGTCAAAGTGAGGTCGGATGGGTACATTGAAGGGGATGGGGGTGATGCAATTGAAGCACACGAATGGAAATGTGTCCGTACAATTGATGGTGTTAGGATCTTTGAGGATGTTGCTGCTTCTCAGAGTGGTAAAGGTGTCCTCACGAAATCTGTTGGTGTTATTGATGCAAATGCAGATATTGTTTTTGAAGTGCTCCTAAACCTTGATCGGCATCAAAGATATGAGTGGGACATGTTGACAGTTGATTTGGAGCTAGTAGATTCTTTGGATGGGCACTATGATATTGTCTACGGAACATATGATCCAAAATATTTTCCTGGTTGGTACTCAAAGAGGGACTTTGTCCTTGCAAGGCAATGGTTTCGTGGACAAGATGGAACCTATACAATCTTGCAATTTCCTTCCACACATAAGAAGCGACCTCCAAGATCTGGATATCGACGAACAAAAATTAATCCTTCTACATGGGAAATCAGAAGGTTAAATACCCCTATGGCTTCAAACACTGCAAGATGTCTTGTGACACACACATTAGAGATGCCTTCTACTAGCTGGTTTACATGGAAGAATAATCACCATTCGAAATTTGAAAATTCTGTTCCTTTTGTGTTACTATGCCAAGTAGCAGGTCTGAAGGAATATATTGGAGCCAATCCTGCTCTAAAATTTGAAGCTTCCACCACTGTTGTCCATTCTACTAGCTCTGAAGTTTCTGTTTCCAATACCGAATATGAGGATACTGAAGTGCGGGATGAGTTCTATGATGCAATTGCTGGTGATTCATTATCTGAAGATGAAGATAGTGACGATGACAATGATGCAGAACTCGACAATGATGATAAAAAAGTGAAGCTGAAGAATGTTTCATGGGCCATCACAAGCTTAGCTTTGAAGAGAATTTCAGCTCTAGATGCAAATAAGGAACTTGATCCGAATGCATCTCCTGTCAATGTCGATCCAAGCCAATTCCACTGTTCAATGCACCAAGGGAAGGATAAAAAGGACACAAATTGCTGGACTACTCTGGATGGTGCAGGATTTATGATCAGAGGAAAGACTTACCTAGAAGATAATTATAAGGTAATGGGAGGAGATCCCCTTCTCAAGCTCATAGCAGTTGATTGGTTTAAAGCTGATAATACAATGAATAAGATTGCATTGCATCCCAAATCTCTTGTTCAGTGCGAAGCTGGAAAAAAGCTCCCATTTATTCTCATCATTAATCTTGAGATTCCAGCAAAACCAAACTATAGTCTGGTTCTCTACTATGCTGCTGACAGGCCAGTGAATAAAAATTCCTTATTGGGTAAATTTGTGGATGGAACTGACATGTTTCGAGATTCAAGGTTCAAACTCATTCCAAGTATCGTGGAGGGTTATTGGATGGTCAAGCGCGCTGTAGGCACAAAAGCTTGCCTCTTGGGGAAAGCAGTGACCTGCAAATACCTCAGACAAGACAATTTTCTGGAGATTGATGTAGATATTGGCTCATCATCAGTAGCAAGGAGTATCATTGGTCTTGTCCTGGGGTATGTCACAAGCATAGTGGTGGATCTTGCAATTTTAATAGAGGCAAAAGAAGAGACAGAACTACCTGAGTACATTCTTGGCACTATTAGACTGAATCGTGTGAAGCTTGACTCTGCCATACCCTTACAGGGTTGA


Protein sequences

Name Description Sequence
hypothetical protein PREDICTED: hypothetical protein [Vitis vinifera].

MAATSAPLSKPGSQGSSERYGSESGAEEKAQRATFEYFGWVYHLGVNSIGREYCHLRFLFVRGKYMEMYKRDPHQFPGIKPIRRGVVGYTLTVEELGRRKLNGGDIYVLRLYNRLDETRKGEIACASAGEARKWMEAFDHAKQQAEYELSRGSGARNKLNMETEINLEGHRHSVRRYAHGLKELIKIGQGPESLLRQSSNLGVKVRSDGYIEGDGGDAIEAHEWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTHTLEMPSTSWFTWKNNHHSKFENSVPFVLLCQVAGLKEYIGANPALKFEASTTVVHSTSSEVSVSNTEYEDTEVRDEFYDAIAGDSLSEDEDSDDDNDAELDNDDKKVKLKNVSWAITSLALKRISALDANKELDPNASPVNVDPSQFHCSMHQGKDKKDTNCWTTLDGAGFMIRGKTYLEDNYKVMGGDPLLKLIAVDWFKADNTMNKIALHPKSLVQCEAGKKLPFILIINLEIPAKPNYSLVLYYAADRPVNKNSLLGKFVDGTDMFRDSRFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCKYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTSIVVDLAILIEAKEETELPEYILGTIRLNRVKLDSAIPLQG

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.530.20
IPR023393
220-419 no description
START-like domain

EAHEWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTHTLEMPSTSWFTWKNNHHSKFENSVPFVLLCQVAGLKEYIGA

superfamily: SSF55961
220-382 Bet v1-like

EAHEWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTHTLEM

HMMPanther: PTHR12136:SF13
223-364 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLN

HMMPanther: PTHR12136
223-364 FAMILY NOT NAMED,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

EWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLN

ProfileScan: PS50848
IPR002913
224-377 START
Lipid-binding START

WKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVT

HMMPfam: PF01852
IPR002913
246-378 START
Lipid-binding START

KGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTH

Seg: seg
426-447 seg

EASTTVVHSTSSEVSVSNTEYE

Seg: seg
462-490 seg

DSLSEDEDSDDDNDAELDNDDKKVKLKNV

HMMPfam: PF07059
IPR009769
541-746 DUF1336
Domain of unknown function DUF1336

WTTLDGAGFMIRGKTYLEDNYKVMGGDPLLKLIAVDWFKADNTMNKIALHPKSLVQCEAGKKLPFILIINLEIPAKPNYSLVLYYAADRPVNKNSLLGKFVDGTDMFRDSRFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCKYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTSIVVDLAILIEAKEETELPEYILGTIRLNRV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox