PRGDB00063856 (lipid binding protein, putative)

From PRG Wiki
Jump to: navigation, search
lipid binding protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223540859 (EQ973844)
Gene Class Unknown
Domain Type
Gene Species Ricinus communis

Comment?

Ricinus communis genomic scaffold scf_1106159300308, whole genome shotgun sequence.

DNA Sequence

GCAAATACTACAGAAGAATTGCCAGAGCGGTTGATTGGTGCGGTTCGTGTTTCTCACATAGAGCTGTCATCAGCTATAGTTCCAAAATTGGACCAAGATCCGTCATGAGTTGATGTTGATATTGGCTCTTCAACTGTTGCTAACGGAGTCCTGGGTCTTGTAATTGGTGTAATCACTACGTTGGTGGTTGACATGGCTTTCCTTGTACAGGGCTCATGGATTGTGCGACAGAGTGTTGGAAGCACTCCTTGCTTACTGGGAAAAGCAGTTGATTGCAATTATATACGTGGTCCCAAGTACTTGGAAGTACCTGGCTCAACACATTACAGTATGGTATTTTACTTTGTAACGAAGGAATTAATACCTGGGTCCCTCTTGCAACGGTTTGTTGATGGTGATGATGAATTCCGTAATAGCAGGTTTAAGCTTATTCCGTCAGTTCCAAAGGTCGCTTCGGAGAAAGGGCTTTTCTCTGTGGTTTTCAATCTGCAAATCCCAGCTGGAAAACATTTAATGGATCTTGTCGCTGTTGATTGGTTCAAAGACACAAAAAGAATGGACCATGTTGCCAGACGTCAAGGTTGTGCAGCACAACCTTGGAAGAAGAACCAGTTGAACCAATTGACTTATCTTGTTTCTCGGGTAATTTACGCCGTGACGACCGTGATAAAGCCCGTGACTGCTGGCGAATTTCTGATGGGAACAACTTTCGAGTTCGTAGCAAGCATTTTTGTTATGACAAATCAAAGGCATATCAAACCAAGAAAGAGAATGAGAATGATATGAGGAGAACAGGACTGCGTGAATGGTTCTCCCAAACAGATGAAAGAGGTGCTCCTCCTAGAATCCCGGTCATGGTTAATATGGCATCTGCTTCTGCTTCTACAAAGAAGAATTTTAAGCTGCAAGAATCTTCTGTTCATCCTGCTCCTTCTCTTGACCAAATAAATGCTGCCAGCAGAAACTCCACTATCATGGATGAATACTCTGATGAGGATGAAGAATATCAAATAGCTGAGGAAGAACAAGAGGTGGAGGATTCAACATAGCCCCTCTAAAACCTCGGAACGGGAGACCTAGAACGCAGGTACAGCATCTTATGCAGATTGATCTTAAAGGATGGGGTGTTGGTTATGTTTCATCATTTCAGCAACATTGTCTTCTTCAGATGTTAAATAGTGTTGCTGTTGTCCTATTTCGTTCCAGAGAGCATGAAAACTGTGGTCCACAACCAGGTTGTGTTCGGGCTCATGTTGAGAGTTTATATGGCCCCGTGACCTTTGCTATGTGAGGTATTGGCGGCGAAATGACGACGGCAGTTATGGTGGGATTGCAGTTTCCAATATGGTAGTTTAGTTGAAGAGGTAGATGGCCATACGGCAATACTCTATCATAGACTTCAGCTAGACTGGTTTCCAGCCCAAGGAGCTGTAGCAGAGCAATGAAGGCTGTAGGGGTTGTTGAGGCTACATGTGAAGAAATATTTGAGCTTGTTATGAGCATGGATGGAACACGATTTGAGACTCCGCATTTTTGAAGAGCTTGTTGAAGTTGATTACCTTGTCCTCCTGATTCAGTATTGGACTGGACACGAGAAGTTGACTCAGAATTGTCAACTCAGAATGCTAACAATCAAGCATTTTCTAGAAAGCATTGGCGTCTCCTACAGTGCCAAAATGGTTCAGTGCACAGGAGGATGAAGATGATGCTAATCCAAATTTATTACGCAGAACTACCATTGGAAATGCATCAGGAGTCACAAGTTGTAAATGGTAACAAATATATTTCGTTTGAGTATAAATCTGGGATGGATAATGGCAGGACTGCTTCCTCATCAGACCATGAAAGTCAATGGCAGCATTTAACATCCAGGAAGCACTAATATGGAAGGAAAAGATTGAGTTTGTAATTGATCAGATGGTTTATGTTTTATCTGTTTACAACAAGAAAGAAAAGTATCATAGAATCACGGTTCCTATCAAGACCATGCTGATTGATGGGAATTGTAGAGTAGAGGATCGTGGCTTGAAGACTCATCATGGGCATATGTCAAAGGTGGTTTACGAGGGATGGATGGTGAGGTATGGGAGAAGGAAGATCGGGAGATCCTTTATACACATGAGGTATTTTGTGCTTGAATCCAGGCTTCTTGCTTACTACAAGAGGAAACCCCAAGATAATCAG


Protein sequences

Name Description Sequence
lipid binding protein, putative lipid binding protein, putative [Ricinus communis].

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKLQESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTALEEEPVEPIDLSCFSGNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIELSSAIVPKLDQDPS

lipid binding protein, putative lipid binding protein, putative [Ricinus communis].

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKLQESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTALEEEPVEPIDLSCFSGNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIELSSAIVPKLDQDPS

lipid binding protein, putative lipid binding protein, putative [Ricinus communis].

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKLQESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTALEEEPVEPIDLSCFSGNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIELSSAIVPKLDQDPS

lipid binding protein, putative lipid binding protein, putative [Ricinus communis].

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKLQESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTALEEEPVEPIDLSCFSGNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIELSSAIVPKLDQDPS

lipid binding protein, putative lipid binding protein, putative [Ricinus communis].

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKLQESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTALEEEPVEPIDLSCFSGNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIELSSAIVPKLDQDPS

lipid binding protein, putative lipid binding protein, putative [Ricinus communis].

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKLQESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTALEEEPVEPIDLSCFSGNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIELSSAIVPKLDQDPS

lipid binding protein, putative lipid binding protein, putative [Ricinus communis].

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKLQESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTALEEEPVEPIDLSCFSGNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIELSSAIVPKLDQDPS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

superfamily: SSF50729
1-117 SSF50729

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQV

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

superfamily: SSF50729
1-117 SSF50729

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQV

superfamily: SSF50729
1-117 SSF50729

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQV

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

superfamily: SSF50729
1-117 SSF50729

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQV

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

superfamily: SSF50729
1-117 SSF50729

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQV

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

superfamily: SSF50729
1-117 SSF50729

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQV

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

HMMPanther: PTHR12136:SF13
1-405 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

superfamily: SSF50729
1-117 SSF50729

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQV

HMMPanther: PTHR12136
1-405 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGNKYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVM

Gene3D: G3DSA:2.30.29.30
IPR011993
2-116 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQ

Gene3D: G3DSA:2.30.29.30
IPR011993
2-116 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQ

Gene3D: G3DSA:2.30.29.30
IPR011993
2-116 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQ

Gene3D: G3DSA:2.30.29.30
IPR011993
2-116 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQ

Gene3D: G3DSA:2.30.29.30
IPR011993
2-116 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQ

Gene3D: G3DSA:2.30.29.30
IPR011993
2-116 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQ

Gene3D: G3DSA:2.30.29.30
IPR011993
2-116 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQ

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVID

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVID

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVID

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVID

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVID

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVID

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVID

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQH

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQH

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQH

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQH

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQH

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQH

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQH

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQ

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQ

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQ

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQ

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQ

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQ

HMMSmart: SM00234
IPR002913
180-392 START
Lipid-binding START

EVDSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQ

superfamily: SSF55961
187-393 SSF55961

TQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQT

superfamily: SSF55961
187-393 SSF55961

TQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQT

superfamily: SSF55961
187-393 SSF55961

TQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQT

superfamily: SSF55961
187-393 SSF55961

TQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQT

superfamily: SSF55961
187-393 SSF55961

TQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQT

superfamily: SSF55961
187-393 SSF55961

TQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQT

superfamily: SSF55961
187-393 SSF55961

TQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQT

Gene3D: G3DSA:3.30.530.20
IPR023393
188-394 G3DSA:3.30.530.20
START-like domain

QNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTD

Gene3D: G3DSA:3.30.530.20
IPR023393
188-394 G3DSA:3.30.530.20
START-like domain

QNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTD

Gene3D: G3DSA:3.30.530.20
IPR023393
188-394 G3DSA:3.30.530.20
START-like domain

QNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTD

Gene3D: G3DSA:3.30.530.20
IPR023393
188-394 G3DSA:3.30.530.20
START-like domain

QNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTD

Gene3D: G3DSA:3.30.530.20
IPR023393
188-394 G3DSA:3.30.530.20
START-like domain

QNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTD

Gene3D: G3DSA:3.30.530.20
IPR023393
188-394 G3DSA:3.30.530.20
START-like domain

QNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTD

Gene3D: G3DSA:3.30.530.20
IPR023393
188-394 G3DSA:3.30.530.20
START-like domain

QNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTD

ProfileScan: PS50848
IPR002913
200-362 START
Lipid-binding START

WRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKG

ProfileScan: PS50848
IPR002913
200-362 START
Lipid-binding START

WRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKG

ProfileScan: PS50848
IPR002913
200-362 START
Lipid-binding START

WRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKG

ProfileScan: PS50848
IPR002913
200-362 START
Lipid-binding START

WRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKG

ProfileScan: PS50848
IPR002913
200-362 START
Lipid-binding START

WRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKG

ProfileScan: PS50848
IPR002913
200-362 START
Lipid-binding START

WRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKG

ProfileScan: PS50848
IPR002913
200-362 START
Lipid-binding START

WRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKG

HMMPfam: PF01852
IPR002913
225-366 START
Lipid-binding START

CSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVG

HMMPfam: PF01852
IPR002913
225-366 START
Lipid-binding START

CSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVG

HMMPfam: PF01852
IPR002913
225-366 START
Lipid-binding START

CSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVG

HMMPfam: PF01852
IPR002913
225-366 START
Lipid-binding START

CSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVG

HMMPfam: PF01852
IPR002913
225-366 START
Lipid-binding START

CSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVG

HMMPfam: PF01852
IPR002913
225-366 START
Lipid-binding START

CSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVG

HMMPfam: PF01852
IPR002913
225-366 START
Lipid-binding START

CSRAMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLKGWGVG

HMMPfam: PF07059
IPR009769
509-713 DUF1336
Domain of unknown function DUF1336

WRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIE

HMMPfam: PF07059
IPR009769
509-713 DUF1336
Domain of unknown function DUF1336

WRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIE

HMMPfam: PF07059
IPR009769
509-713 DUF1336
Domain of unknown function DUF1336

WRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIE

HMMPfam: PF07059
IPR009769
509-713 DUF1336
Domain of unknown function DUF1336

WRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIE

HMMPfam: PF07059
IPR009769
509-713 DUF1336
Domain of unknown function DUF1336

WRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIE

HMMPfam: PF07059
IPR009769
509-713 DUF1336
Domain of unknown function DUF1336

WRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIE

HMMPfam: PF07059
IPR009769
509-713 DUF1336
Domain of unknown function DUF1336

WRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRQGCAAQVASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLVQANTTEELPERLIGAVRVSHIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox