PRGDB00063857 (conserved hypothetical protein)

From PRG Wiki
Jump to: navigation, search
conserved hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223530557 (EQ974164)
Gene Class Unknown
Domain Type
Gene Species Ricinus communis

Comment?

Ricinus communis genomic scaffold scf_1106159303852, whole genome shotgun sequence.

DNA Sequence

ATGGAAGGGTGGTTATATCTAGTACGTTCAAATCGGATTGGGTTGCAGTACTCAAGAAAACGTTACTTTGTTCTTGAAAATCATCTTCTTCAGAGCTTTAAGTCTCTTCCTTCTTCTAAGCATGAGGTTTTCTTCATTTTTACACTCTACAATACTTCTAATCACAATGATCAACTTAAGCTGGGAGCAAGCAGTCCTGAAGAAGCAGCAAGATGGATTCATTCTATTCAAGAGGCAGCTTTAAAGGGTGATCAGAATACCGTTGGCTGTTCAAAGAGCAGTTGGCAGTCCTTTAAGTTGATTGGCTCCAGTCGTGTAAGCCACAGCAAACCCATAGACTGGACTCTTTGCTCATTGACACACAGTGATCCAGTGACTGATGTTATCGCACCTTCACCTTGGACAATCTTTGGGTGTCAGAATGGTTTACGTCTCTTTAAAGAAGCAAAAGATCGGGATTCTCATGTTAAGTGGGATGATCATCCTGCAATAATGGCCGTGGGTGTGGTTGATGGAACTTCAGAAGCCATTTTTCAAACTCTTATGTCTCTTGGTCCTTCAAGATCAGAATGGGACTTCTGTTTCTACAAGGGTAGTGTGGTTGAGCACCTTGATGGTCATACCGATATTATTCACAAGATGTTATATAATGATTGGTTGCCTTGGGGAATGAAAAGAAGAGATCTTTTGTTGAGACGTTACTGGAGAAGGGAAGATGATGGAACGTATGTTATTCTCTACCATTCTGTGTTTCACAAGAAGTGTCCTCCCCAGAAAGGCTATGTTCGTGCTTGCCTTAAAAGTGGAGGATATGTCATCTCTCCTGTAAATCAAGGGAAACGATCTGTAGTAAAGCACATGCTTGCTATTGACTGGAAATTCTGGAAATCATATCTACGAACTTCATCAGCTCGATCTATTACCATCCGAATGCTTGGCAGAGTTGCGGCATTACGAGAGTTGTTCAGAGCAAAACTGGGAACTTGTCCTTCCTCTGAATTTTCATCAGGAGAGTTGACAAGAAATATTAAGTTGCATCAGAGTGAAGAGGATAGGAAGGTTGGTGATGGGAAAACTAAAGAATATTTAAGCGAGGAAGTAGATAAAGCACCTTCAGAACATGCCAGCCTTGGAGGCCTGAATGATGCTGCTGATGAGTTTTTTGATGTTCCAGAACCCTCGGATCATGAACAATCTGATAGCGGCTGGAGCTATGACTTCGGCCCTGAAACATACTCTCAGGATATGAGGCAACCCAAGTTATGTACTGCTGCTGGTTTTGTGAAGAAATTGCATGATCTTGCGGTTCAAAAGAGGGGTTATGTTGACTTGCAAGAGATGGCAAGGGAAGACAGTATTTCGTGCTGCTATGGAACTACTCTTCCAAAAGACCCAACTTGCAGTATGCTTTCTAGTTGGACAGCAGCTGATCCTTCTACCTTTTTAATCCGTGGAGAGAATTATCTTGAAGACCAGAAGAAGTTTAAGGCAAAAGGAACATTGATGCAAATGGTTGCAGCGGACTGGCTTAGATCTAACAAGAGAGAAGATGATCTTGCTGGCCGTCCAGGTAGCATTGTTCAGAAATATGCTGCACAGGGTGGGCCAGAGTTCTTTTTCATTATAAACATACAAGTCCCAGGCTCAACTACATATAGCCTTGCTCTATACTATATGATGACTACGCCTCTGGAAGATGCACCCTTGTTAGAGAGATTTGTCAAGGGGGATGATGCATTTAGAAATTCAAGGTTTAAGCTCATACCTTACATATCTAAGGGTTCATGGATAGTTAAGCAAAGTGTGGGAAAGAAAGCATGCCTGATTGGCCAAGCACTGGAAATTAATTATTTCCGTGGGGAGAACTACCTTGAGCTTGGAGTTGATATTGGGTCATCAACCGTTGCAAGGGGCGTGGTCAGTCTCGTGCTTGGTTACCTCAGCAATTTGGTTATTGAAATGGCATTTTTGATTCAGGCAAACACGCCAGAGGAGCTGCCAGAGTATCTTCTCGGAACCTGCAGGCTTAACCATCTGGATGCCTCCAAAGCAGTTTTACTGGATTCATGA


Protein sequences

Name Description Sequence
conserved hypothetical protein conserved hypothetical protein [Ricinus communis].

MEGWLYLVRSNRIGLQYSRKRYFVLENHLLQSFKSLPSSKHEVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIQEAALKGDQNTVGCSKSSWQSFKLIGSSRVSHSKPIDWTLCSLTHSDPVTDVIAPSPWTIFGCQNGLRLFKEAKDRDSHVKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFRAKLGTCPSSEFSSGELTRNIKLHQSEEDRKVGDGKTKEYLSEEVDKAPSEHASLGGLNDAADEFFDVPEPSDHEQSDSGWSYDFGPETYSQDMRQPKLCTAAGFVKKLHDLAVQKRGYVDLQEMAREDSISCCYGTTLPKDPTCSMLSSWTAADPSTFLIRGENYLEDQKKFKAKGTLMQMVAADWLRSNKREDDLAGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMTTPLEDAPLLERFVKGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGENYLELGVDIGSSTVARGVVSLVLGYLSNLVIEMAFLIQANTPEELPEYLLGTCRLNHLDASKAVLLDS

Domains

Domain Start-End Description Sequence

superfamily: SSF50729
1-79 SSF50729

MEGWLYLVRSNRIGLQYSRKRYFVLENHLLQSFKSLPSSKHEVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIQEA

ProfileScan: PS50003
IPR001849
1-81 PH_DOMAIN
Pleckstrin homology domain

MEGWLYLVRSNRIGLQYSRKRYFVLENHLLQSFKSLPSSKHEVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIQEAAL

HMMSmart: SM00233
IPR001849
1-83 PH
Pleckstrin homology domain

MEGWLYLVRSNRIGLQYSRKRYFVLENHLLQSFKSLPSSKHEVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIQEAALKG

Gene3D: G3DSA:2.30.29.30
IPR011993
1-81 PH_type
Pleckstrin homology-like domain

MEGWLYLVRSNRIGLQYSRKRYFVLENHLLQSFKSLPSSKHEVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIQEAAL

HMMSmart: SM00234
IPR002913
123-324 START
Lipid-binding START

DPVTDVIAPSPWTIFGCQNGLRLFKEAKDRDSHVKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFRA

Gene3D: G3DSA:3.30.530.20
IPR023393
132-323 G3DSA:3.30.530.20
START-like domain

SPWTIFGCQNGLRLFKEAKDRDSHVKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFR

HMMPanther: PTHR12136
132-295 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

SPWTIFGCQNGLRLFKEAKDRDSHVKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFW

superfamily: SSF55961
132-325 SSF55961

SPWTIFGCQNGLRLFKEAKDRDSHVKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFRAK

HMMPanther: PTHR12136:SF13
132-295 PTHR12136:SF13,SUBFAMILY NOT NAMED

SPWTIFGCQNGLRLFKEAKDRDSHVKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFW

ProfileScan: PS50848
IPR002913
134-291 START
Lipid-binding START

WTIFGCQNGLRLFKEAKDRDSHVKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAID

HMMPfam: PF01852
IPR002913
159-295 START
Lipid-binding START

DDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFW

HMMPfam: PF07059
IPR009769
473-680 DUF1336
Domain of unknown function DUF1336

WTAADPSTFLIRGENYLEDQKKFKAKGTLMQMVAADWLRSNKREDDLAGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMTTPLEDAPLLERFVKGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGENYLELGVDIGSSTVARGVVSLVLGYLSNLVIEMAFLIQANTPEELPEYLLGTCRLNHLD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox