PRGDB00063859 (unnamed protein product)

From PRG Wiki
Jump to: navigation, search
unnamed protein product
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32977300 (AK067282)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cDNA clone:J013102K12, full insert sequence.

DNA Sequence

ATGGCCACGATCACCTTGAAGCCGCCGGCGACGGCGGCGGCGGCGGGAGGGGAGGTGTCCGAGGTGGAGCTCTCGGAGGCGGGATCGCCGGATGTCGGCAGCCAGAGCAGCGGGAGCGGTGGGAGCGGGCGGAGCACGGCGGGGTCCTCCGGGTGGGTGTACCACCTCGGCGTGAACTCCATCGGCCACGAGTACCGCCACCTCCGGTTCCTCGTCATCCGCGGCAAGACGGTGGCCATGTACAAGCGCGACCCGAGCAAGAACCCCGGAATCCAACCTATCCGAAAGGGTGTTGTAAGTCACACTCTTATGGTGGAGGAGCTTGGTCGCCGGATTACTAGCCATGGGGAACTGTATGTCTTGCGGTTTTACAATCGGTTGGATCAAACAAAGAAAGGAGAGATTGCATGTGGGGACCCCGGTGAAGCTAGGAAATGGGTTGAAGCATTTGAGCAGGCAAAACAGCAGGCTGATTATGACCTGATGACGAGAGGGGTTAGTTGGAATAGATCCCAGAATGAAAACGAGCTTAATCTTGATGGGCATCGACCACGTGTAAGGAGATATGCACAAGGCTTGGGGAAACTTGTACGAATTGGTAAAGGGCCAGAAAAGCTCTTGCGGCAGTCTTCAAATCTTCAAAGCCATGAGATAATTAATACAAACTTTGGAGGCGATTCTGGAGATGCATTCGAAGCACACGAATGGAGATATGTTCGAACATTTAATGGTATAAGAATTTTTGAAGATATTGCAAACACAAAGGGTGGAAAAGGGGTACTTCTTAAGTCTGTTGGTGTGGTTGGGGCGAATCCTGATACTGTATTTGCAGTGGTTCTCAGCTCTGATAAGCATAAGCGATATGAGTGGGATATGCTGACTGCCGATTTGGAATTGGTAGAAACAATTGATGGATACTATGACGTGGTTTATGGAACCTATGAACCTAGATATTTAAGCTGGTGGAAAACAAAGAAGGATTTTGTTTTTTCCAGACAATGGTTTCGTGGACAAGATGGGGCATATACCATTTTGCAGATTCCTGCTTGTCACAAGAACAAACCTCCAAGGCATGGCTACGAGCGTACAAAAATCAATTCCTCAACATGGGAACTAAGAAGGTTGAACCCACCAGGATCATCAACTCCGAAATGCCTTGTTACTCATATGTTGGAAATGAGCCCAAGTTTTTGGGATAGATGGAAGAGAAGACATAACGAGAATTTTGACAGAAGTATTGCTTTTGCTTTGCTCAGCCAAGTAGCAGGTCTAAGAGAATACTTTGCAGCAAATCCAGCTTTGACATCTGATTTGCCTTCAACAGTAGTGAAGCCCAAACAGTCTGATTCTTTGATCATCCAGAGTGAACTGGAAGATTCTGAACTTAATGATGAATTCTATGATGCACTTGCTAGAGGCGAATCCTTTGAAGATGAGGATAGTGATGACGATGATGATATGATTCCTAAGGCTGGAAAAGTGAAGTTCAAGAATATTTCATGGGCTATCGCAGGTCTTGCTATGAAACCGACTAAAGCTTCGGTTGAGAAGAGTGAATTGGTTACAAATTCAACTCCGGTAACTATTGATTCAAACCATTTCCATGGCACCCTTCGACGAGCGAAAAGTGAGAATGACCCAAACTCTTGGAGTGAGCCTGGTGGAGAGAAGTTCATGATAAGAGGAAAGACTTACCTGACAGATTACACTAAGGTTGTTGGAGGTGATCCCCTTCTAAAGCTTATTGCTGTCGATTGGTTTAAGGCTGATGAGCGTTTTGATTCAGTTGCCTTACACCCCAAGAGCCTCGTTCAGTCAGAAGCTGCAAAGAAGATTCCCTTCATACTGGTCATAAACTTGCAGGTTCCAGCGAAGCCAAACTATAACTTGGTCATGTACTACGCAGCAGAAAGGCCCGTGAATAAAGATTCTCTGTTGGGAAGATTCATTGATGGAACCGATGCGTTCCGAGATGCCAGATTTAAACTTATACCAAGCATTGTTGAGGGTTATTGGATGGTAAAACGTGCAGTTGGAACAAAAGCTTGTCTTCTGGGAAAAGCAGTAACATGCAATTACCTTCGCCAGGATAACTTTCTAGAGATAGATGTTGACATTGGTTCTTCATCCGTTGCACGGAGCATTATTGGTCTAGTCCTGGGATATGTCACAGGCCTTGTTGTTGATCTTGCTATTCTAATTGAGGCAAAGGAAGAGAAAGAGCTGCCTGAATACATTCTTGGCACAGTTCGCCTAAATCGTGCGAATCCCGACTCTGCAGTACCCATCTAA


Protein sequences

Name Description Sequence
unnamed protein product unnamed protein product [Oryza sativa Japonica Group].

MATITLKPPATAAAAGGEVSEVELSEAGSPDVGSQSSGSGGSGRSTAGSSGWVYHLGVNSIGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIQPIRKGVVSHTLMVEELGRRITSHGELYVLRFYNRLDQTKKGEIACGDPGEARKWVEAFEQAKQQADYDLMTRGVSWNRSQNENELNLDGHRPRVRRYAQGLGKLVRIGKGPEKLLRQSSNLQSHEIINTNFGGDSGDAFEAHEWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAANPALTSDLPSTVVKPKQSDSLIIQSELEDSELNDEFYDALARGESFEDEDSDDDDDMIPKAGKVKFKNISWAIAGLAMKPTKASVEKSELVTNSTPVTIDSNHFHGTLRRAKSENDPNSWSEPGGEKFMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHPKSLVQSEAAKKIPFILVINLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDARFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTGLVVDLAILIEAKEEKELPEYILGTVRLNRANPDSAVPI

Domains

Domain Start-End Description Sequence

HMMSmart: SM00233
IPR001849
47-157 PH
Pleckstrin homology domain

AGSSGWVYHLGVNSIGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIQPIRKGVVSHTLMVEELGRRITSHGELYVLRFYNRLDQTKKGEIACGDPGEARKWVEAFEQAKQQA

superfamily: SSF55961
215-431 SSF55961

SHEIINTNFGGDSGDAFEAHEWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAAN

Gene3D: G3DSA:3.30.530.20
IPR023393
231-431 G3DSA:3.30.530.20
START-like domain

FEAHEWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAAN

HMMPanther: PTHR12136:SF13
235-376 PTHR12136:SF13,SUBFAMILY NOT NAMED

EWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLN

HMMPanther: PTHR12136
235-376 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

EWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLN

ProfileScan: PS50848
IPR002913
236-401 START
Lipid-binding START

WRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRW

HMMPfam: PF01852
IPR002913
258-391 START
Lipid-binding START

KGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHML

HMMPfam: PF07059
IPR009769
550-755 DUF1336
Domain of unknown function DUF1336

WSEPGGEKFMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHPKSLVQSEAAKKIPFILVINLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDARFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTGLVVDLAILIEAKEEKELPEYILGTVRLNRA


List of References

, National Institute of Agrobiological Sciences Rice Full-Length cDNA Project Team, Shoshi Kikuchi, Kouji Satoh, Toshifumi Nagata, Nobuyuki Kawagashira, Koji Doi, Naoki Kishimoto, Junshi Yazaki, Masahiro Ishikawa, Hitomi Yamada, Hisako Ooka, Isamu Hotta, Keiichi Kojima, Takahiro Namiki, Eisuke Ohneda, Wataru Yahagi, Kohji Suzuki, Chao Jie Li, Kenji Ohtsuki, Toru Shishiki, Foundation of Advancement of International Science Genome Sequencing & Analysis Group, Yasuhiro Otomo, Kazuo Murakami, Yoshiharu Iida, Sumio Sugano, Tatsuto Fujimura, Yutaka Suzuki, Yuki Tsunoda, Takashi Kurosaki, Takeko Kodama, Hiromi Masuda, Michie Kobayashi, Quihong Xie, Min Lu, Ryuya Narikawa, Akio Sugiyama, Kouichi Mizuno, Satoko Yokomizo, Junko Niikura, Rieko Ikeda, Junya Ishibiki, Midori Kawamata, Akemi Yoshimura, Junichirou Miura, Takahiro Kusumegi, Mitsuru Oka, Risa Ryu, Mariko Ueda, Kenichi Matsubara, RIKEN, Jun Kawai, Piero Carninci, Jun Adachi, Katsunori Aizawa, Takahiro Arakawa, Shiro Fukuda, Ayako Hara, Wataru Hashizume, Norihito Hayatsu, Koichi Imotani, Yoshiyuki Ishii, Masayoshi Itoh, Ikuko Kagawa, Shinji Kondo, Hideaki Konno, Ai Miyazaki, Naoki Osato, Yoshimi Ota, Rintaro Saito, Daisuke Sasaki, Kenjiro Sato, Kazuhiro Shibata, Akira Shinagawa, Toshiyuki Shiraki, Masayasu Yoshino, Yoshihide Hayashizaki, Ayako Yasunishi
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science: 2003, 301(5631);376-9
PubMed:12869764 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox