PRGDB00063863 (resistance gene candidate NBS-type protein)

From PRG Wiki
Jump to: navigation, search
resistance gene candidate NBS-type protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 165967911 (EU239820)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Musa acuminata subsp. malaccensis

Comment?

Musa acuminata subsp. malaccensis resistance gene candidate NBS-type protein (RGC2) gene, partial cds.

DNA Sequence

ATGGCTGGTGTCACATCACAGGCAGCGGCGGTGTTCTCCCTGGTGAATGAAATCTTTAACCGGTCCATCAATTTGATCGTCGCGGAACTCCGGTTGCAGTTGAATGCGAGAGCCGAGCTGAACAATCTGCAGAGAACACTATTGAGGACTCACTCTCTGCTCGAGGAGGCAAAGGCGAGGCGGATGACTGACAAGTCTCTCGTGCTGTGGCTGATGGAGCTCAAGGAATGGGCCTACGACGCCGACGACATCCTCGACGAGTACGAGGCCGCAGCAATCCGACTGAAGGTAACACGCTCGACCTTCAAACGTCTTATCGATCATGTGATTATAAATGTTCCATTAGCGCACAAAGTAGCAGACATCAGGAAAAGGTTGAACGGGGTCACTCTTGAGAGGGAGCTAAATCTGGGTGCGCTGGAAGGGTCGCAGCCGCTTGATTCCACGAAAAGAGGTGTGACCACTTCTCTTCTGACTGAATCTTGTATTGTCGGGCGAGCTCAAGATAAGGAGAATTTGATTCGGTTGCTGTTGGAGCCCAGCGATGGGGCGGTTCCTGTTGTTCCTATAGTTGGATTAGGAGGGGCAGGGAAGACGACTCTGTCTCAGCTTATCTTTAATGACAAGAGAGTGGAGGAGCATTTCCCATTGAGAATGTGGGTGTGTGTGTCTGACGATTTTGATGTGAAGAGAATTACTAGAGAGATCACAGAGTACGCCACCAACGGAAGGTTCATGGATCTCACCAACTTGAATATGCTTCAAGTTAATCTGAAAGAGGAGATAAGGGGGACGACATTTTTGCTTGTGCTGGATGATGTGTGGAACGAAGACCCCGTGAAGTGGGAAAGCCTGTTAGCCCCATTAGATGCCGGAGGACGGGGAAGCGTGGTCATTGTGACGACACAGAGCAAAAAGGTCGCCGATGTCACCGGCACGATGGAGCCATACGTTCTCGAGGAGTTAACGGAGGATGACAGTTGGTCACTCATCGAGAGTCACTCCTTCAGGGAGGCGAGCTGCTCTAGTACAAATCCTAGAATGGAAGAGATCGGGAGGAAGATAGCCAAGAAGATCAGTGGCCTACCTTACGGAGC


Protein sequences

Name Description Sequence
resistance gene candidate NBS-type protein resistance gene candidate NBS-type protein [Musa acuminata subsp. malaccensis].

MAGVTSQAAAVFSLVNEIFNRSINLIVAELRLQLNARAELNNLQRTLLRTHSLLEEAKARRMTDKSLVLWLMELKEWAYDADDILDEYEAAAIRLKVTRSTFKRLIDHVIINVPLAHKVADIRKRLNGVTLERELNLGALEGSQPLDSTKRGVTTSLLTESCIVGRAQDKENLIRLLLEPSDGAVPVVPIVGLGGAGKTTLSQLIFNDKRVEEHFPLRMWVCVSDDFDVKRITREITEYATNGRFMDLTNLNMLQVNLKEEIRGTTFLLVLDDVWNEDPVKWESLLAPLDAGGRGSVVIVTTQSKKVADVTGTMEPYVLEELTEDDSWSLIESHSFREASCSSTNPRMEEIGRKIAKKISGLPYGA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-290 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VFSLVNEIFNRSINLIVAELRLQLNARAELNNLQRTLLRTHSLLEEAKARRMTDKSLVLWLMELKEWAYDADDILDEYEAAAIRLKVTRSTFKRLIDHVIINVPLAHKVADIRKRLNGVTLERELNLGALEGSQPLDSTKRGVTTSLLTESCIVGRAQDKENLIRLLLEPSDGAVPVVPIVGLGGAGKTTLSQLIFNDKRVEEHFPLRMWVCVSDDFDVKRITREITEYATNGRFMDLTNLNMLQVNLKEEIRGTTFLLVLDDVWNEDPVKWESLLAPLD

HMMPanther: PTHR23155:SF121
11-290 PTHR23155:SF121,SUBFAMILY NOT NAMED

VFSLVNEIFNRSINLIVAELRLQLNARAELNNLQRTLLRTHSLLEEAKARRMTDKSLVLWLMELKEWAYDADDILDEYEAAAIRLKVTRSTFKRLIDHVIINVPLAHKVADIRKRLNGVTLERELNLGALEGSQPLDSTKRGVTTSLLTESCIVGRAQDKENLIRLLLEPSDGAVPVVPIVGLGGAGKTTLSQLIFNDKRVEEHFPLRMWVCVSDDFDVKRITREITEYATNGRFMDLTNLNMLQVNLKEEIRGTTFLLVLDDVWNEDPVKWESLLAPLD

superfamily: SSF52540
146-364 SSF52540

LDSTKRGVTTSLLTESCIVGRAQDKENLIRLLLEPSDGAVPVVPIVGLGGAGKTTLSQLIFNDKRVEEHFPLRMWVCVSDDFDVKRITREITEYATNGRFMDLTNLNMLQVNLKEEIRGTTFLLVLDDVWNEDPVKWESLLAPLDAGGRGSVVIVTTQSKKVADVTGTMEPYVLEELTEDDSWSLIESHSFREASCSSTNPRMEEIGRKIAKKISGLPY

Gene3D: G3DSA:3.40.50.300
165-309 G3DSA:3.40.50.300

GRAQDKENLIRLLLEPSDGAVPVVPIVGLGGAGKTTLSQLIFNDKRVEEHFPLRMWVCVSDDFDVKRITREITEYATNGRFMDLTNLNMLQVNLKEEIRGTTFLLVLDDVWNEDPVKWESLLAPLDAGGRGSVVIVTTQSKKVAD

HMMPfam: PF00931
IPR002182
168-363 NB-ARC,NBS
NB-ARC

QDKENLIRLLLEPSDGAVPVVPIVGLGGAGKTTLSQLIFNDKRVEEHFPLRMWVCVSDDFDVKRITREITEYATNGRFMDLTNLNMLQVNLKEEIRGTTFLLVLDDVWNEDPVKWESLLAPLDAGGRGSVVIVTTQSKKVADVTGTMEPYVLEELTEDDSWSLIESHSFREASCSSTNPRMEEIGRKIAKKISGLP

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

VVPIVGLGGAGKTTLS

FPrintScan: PR00364
IPR000767
261-275 DISEASERSIST
Disease resistance protein

EIRGTTFLLVLDDVW

FPrintScan: PR00364
IPR000767
359-366 DISEASERSIST
Disease resistance protein

ISGLPYGA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox