PRGDB00063873 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7268697 (AL161550)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 50.

DNA Sequence

GCAAATACAGCGGAAGAACAGCCAGAGAGGCTTATCGGTGCAGTTCGGGTTTCGCATATTGAGCTCTCTTCGGCTATAGTTCCGAATCTGGAGTCAGAATAAATTGACGTAGATATTGGTTCATCAACCGTTGCAAATGGAGTGCTCGGCCTCGTCATTGGCGTAATCACGTCTCTGGTTGTGGAAATGGCTTTCCTTGTACAGGTTCCAGGATCAACACACTACAGTATGGTGTTTTATTTCGTGATGAAAGAACTAGTACCTGGGTCCCTCTTGCAACGGTTTGTGGATGGTGATGATGAATTCCGAAATAGTAGGCTAAAGCTTATACCATTAGTTCCTAAGGTTGCTGCAGAAAAAGGTCTATTCTCAATGGTGGTAAATGTTCAACCAACTAACTTTTGTTTCTGTCCATTTAACACTATACGGAAGATACCTGCTGGCAAGCATCTTATGGATCTCGTTGCTGTTGACTGGTTCAAAGACAGTAAAAGAATAGATCATGTTGCTAGACGCAAAGGCTGCGCAGCACAAAAGAAGAACCTGCTCACAACATTGATCTGTCATGCTTCTCGGGTAACCTAAAGCGCAATGAAAACGAAAACGCCCGTAACTGCTGGAGGATTTCTGATGGTAACAACTTCAAAGTTCGGGGCAAGAATTTCGGTCAAGAGAAAAGAAAGCATCCGAAATTGAATCGTCATTCTTGTGTACTATTTCAGCCTGAAACAAGTAAACCAGAGACCGATGTCAAGAGACCAGGTTTGCGGGAATGGTTTTCACAGACAGATGAGAGAGGTGTTCATACCCGGATCCCTGTCATGGTTAATATGGCATCATCTTCCTTGAGCTTGACTAAGAGTGGGAAGTCTCTGCATAAGTCTGCCTTTTCTCTTGATCAAACAAATTCCGTTAACAGAAACTCCTTGCTTATGGATGAAGACTCGGATGATGATGATGAATTTCAGATTGCTGAATCAGAACAAGAGGTGGAGGATATAATATTTCCCCACTAAAGCCTCGGAATGGGAGGCCTAGAACGCAAGTGCAACATCTAATACAAATTGATCTAAAAGGGTGGGGTGCAGGCTATCTTCCAGCATTTCAACAACATTGTCTTCTTCAAATGCTGAATAGTGTTGCTGGATTGTGTGGCCTCGCGACCTCTGTTATGTCCGCTATTGGCGCCGTAATGATGATGGGAGTTATGGTGGGACTGCAGCTTTCAGTTTGGTAGCTTAGTGGAAGAGGTCGATGGTCACACAGCAGTCCTCTATCACAGACTTCTGCTCGACTGGTTTCCAATCCAAGAAGCTGTAGCAGGGCAATGAAGGCTGTTGGTGTAGTGGAGGCAACATGTGAGGAAATATTCGAGCTTCTGATGAGCATGGACGGCACTCGTTATGAGTCTTCGGATTTTTGAAGAGCTTCTTGAAGTTGATTACCTTGGGCTCTAGAAGATGCTGCTATATCTGAAATGCAATTTATTTGATATGCATATACTTATGCAAAACAAGATCTGCAATTTCCTTTAGATTTAGTGCGGCAGAGGATGAAGAGGACTCTCGACGTAGCTTAATGAGGAGGACAACTATTGGAAATGCATCAAGAGTCCCAAGTTCCAAATGGTCAGCAGTATGTTTCATTTGAATATAAATCTGGAATGGATACTGGAAGGACTGCTTCATCTTCAGACCATGAAAGCCAATGGCAGCGTTCAACATTCAGGAAGCACTAATGTGGAAGGAAAAAATTGAGTCTGTTATAGACCAGATGGTTTACGTTTTGTCTGTCTATAACAAAAAAGAAAAGAGTCATAGAATTACGGTTCCTATCAAGACCATGTTAATTGATGGTAACTGCAGAGTTGAGGATCGAGGCTTGAAAACACATCATGGACATATGTCTAAGGTAGTGTACGAAGGATGGATGGTTAGGTATGGAAGGAGGAAGATCGGACGATCGTATATTCATATGAGGTATTTTGTGTTGGAGCCTCGTCTTTTGGCGTATTACAAGAAGAAACCTCAGGATTATCAG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Arabidopsis thaliana].

MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVPNGQQYVSFEYKSGMDTGRTASSSDHESHLICIYLCKTRSAISFRFSAAEDEEDSRRSLMRRTTIGNGALEDAAISEMQFSLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSYGGGYNISPLKPRNGRPRTQVQHLIQIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSLTKSGKSLHKSAFSLDQTNSVNRNSLLMDEDSDDDDEFQIAESEQEHPKLNRHSCVLFQPETSKPETDVKRPEEEPAHNIDLSCFSGNLKRNENENARNCWRISDGNNFKVRGKNFGQEKRKPTNFCFCPFNTIRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQVAAEKGLFSMVVNVQVPGSTHYSMVFYFVMKELVPGSLLQRFVDGDDEFRNSRLKLIPLVPKIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQANTAEEQPERLIGAVRVSHIELSSAIVPNLESE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12136:SF13
1-371 PTHR12136:SF13,SUBFAMILY NOT NAMED

MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVPNGQQYVSFEYKSGMDTGRTASSSDHESHLICIYLCKTRSAISFRFSAAEDEEDSRRSLMRRTTIGNGALEDAAISEMQFSLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSYGGGYNISPLKPRNGRPRTQVQHLIQIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVM

HMMPanther: PTHR12136
1-371 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVPNGQQYVSFEYKSGMDTGRTASSSDHESHLICIYLCKTRSAISFRFSAAEDEEDSRRSLMRRTTIGNGALEDAAISEMQFSLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSYGGGYNISPLKPRNGRPRTQVQHLIQIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVM

Gene3D: G3DSA:2.30.29.30
IPR011993
2-118 PH_type
Pleckstrin homology-like domain

SKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVP

ProfileScan: PS50003
IPR001849
3-110 PH_DOMAIN
Pleckstrin homology domain

KVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVID

superfamily: SSF50729
3-118 SSF50729

KVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVP

HMMSmart: SM00233
IPR001849
4-112 PH
Pleckstrin homology domain

VVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVEDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQH

HMMSmart: SM00234
IPR002913
177-358 START
Lipid-binding START

MRRTTIGNGALEDAAISEMQFSLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSYGGGYNISPLKPRNGRPRTQVQHLIQIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQ

superfamily: SSF55961
194-359 SSF55961

EMQFSLRIFEELLEVDYLPRSCSRAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSYGGGYNISPLKPRNGRPRTQVQHLIQIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQT

Gene3D: G3DSA:3.30.530.20
IPR023393
211-298 G3DSA:3.30.530.20
START-like domain

LPRSCSRAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSY

HMMPfam: PF01852
IPR002913
216-298 START
Lipid-binding START

SRAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSY

ProfileScan: PS50848
IPR002913
217-298 START
Lipid-binding START

RAMKAVGVVEATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRRNDDGSY

Gene3D: G3DSA:3.30.530.20
IPR023393
300-360 G3DSA:3.30.530.20
START-like domain

GGYNISPLKPRNGRPRTQVQHLIQIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQTD

HMMPfam: PF07059
IPR009769
481-611 DUF1336
Domain of unknown function DUF1336

WRISDGNNFKVRGKNFGQEKRKPTNFCFCPFNTIRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQVAAEKGLFSMVVNVQVPGSTHYSMVFYFVMKELVPGSLLQRFVDGDDEFRNSRLKLIPLVP

HMMPfam: PF07059
IPR009769
613-667 DUF1336
Domain of unknown function DUF1336

IDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQANTAEEQPERLIGAVRVSHIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox