PRGDB00063881 (T7N9.24)

From PRG Wiki
Jump to: navigation, search
T7N9.24
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7958619 (AC000348)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Genomic sequence for Arabidopsis thaliana BAC T7N9 from chromosome I, complete sequence.

DNA Sequence

ATGAGTGTGGTTTTGCAAATTACGAAGGACTGGGTCCAAGCCTTGCTTGGATTTTTGTTACTATCATTTGCAAACATTAGCACAAGAACCAATCATAAGCATTTTCCACATGGAAGCTGCTCCTCAATCATGGCTGGTTTTTGGATCTATATGTACATATATTCATATCTTTTCATTACATTAAAAATCATTGATTTAACATCTGTGAAGTTTATGAACACATCATATTACGTAAACGCACATGCACAACTTTATTTCGTTAGTGCAGTTTTTGAAGTCTATTTTTGTCATGGCATTTTACTTTATATACCCAATATAATACTTCGTACCAAAAGGATGAATGGACTTTAG


Protein sequences

Name Description Sequence
T7N9.28 T7N9.28 [Arabidopsis thaliana].

MSVVLQITKDWVQALLGFLLLSFANISTRTNHKHFPHGSCSSIMAGFWIYMYIYSYLFITLKIIDLTSVKFMNTSYYVNAHAQLYFVSAVFEVYFCHGILLYIPNIILRTKRMNGL

T7N9.24 T7N9.24 [Arabidopsis thaliana].

MELPDVPVWRRVIVSAFFEALTFNIDIEEERSEIMMKTGAVVSNPRSRVKWDAFLSFQRDTSHNFTDRLYEALVKEELRVWNDDLERVDHDHDHELRPSLVEAIEDSVAFVVVLSPNYANSHLRLEELAKLCDLKCLMVPIFYKVEPREVKEQNGPFEKDFEEHSKRFGEEKIQRWKGAMTTVGNISGFICGYEIQLEMETGVVPNRLKYSVFLSFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMNLVGNIPGYVCTAKTVGDDNEGINREKVDDMIDLVVKKVVAAVRNRPEIVADYTVGLESPIKDLMKLFNTESSSGIQVMGLYGMGGIGKTTLAKAFYNKIIVNFNRHRVFIESVRGKSSDQDGLVNLQKTLIKELFRLVPEIEDVSIGLEKIKENVHEKKIIVVLDDVDHIDQVNALVGETSWYGEGSLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSFYSLRKEKPPTQGLLELSKKIAEVTGLLPLAVKVFGSHFYDKDENEWQVELEKLKTQQDKLHGVLALSFKSLDEEEKKIFLDIACLFLKMDITKEEVVDILKGCGLNAEAALRVLIQKSLLTILTDDTLWMHDQIRDMGRQMVHKESSDDPEMRSRLWDRGEIMNVLDYMKGTSSIRGIVLDFNKKFARDHTADEIFSSNLRNNPGIYSVFNYLKNKLVRFPAEEKPKRSEITIPVESFAPMKKLRLLQINNVELEGDLKLLPSELKWIQWKGFPLENLPPDILSRQLGVLDLSESGVRRVKTLPRKRGDENLKVVNLRGCHGLEAIPDLSNHNALEKLVLERCNLLVKVPRSVGNLGKLLQLDLRRCSSLSEFLGDVSGLKCLEKFFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPYSIFRLQKLEKLSLMGCRSIEELPSCVGYLTSLEDLYLDDTALRNLPSSIGDLKNLQKLHLMRCTSLSTIPETINKLMSLKELFINGSAVEELPIETGSLLCLTDLSAGDCKFLKQVPSSIGGLNSLLQLQLDSTPIEALPEEIGDLHFIRQLDLRNCKSLKALPKTIGKMDTLYSLNLVGSNIEELPEEFGKLENLVELRMNNCKMLKRLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMVLEMLKKPLFRISESNVPGTSEEPRFVEVPNSFSKLLKLEELDACSWRISGKIPDDLEKLSCLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANCFSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKKRLSKASLKMMRNLSLPGNRVPDWFSQGPVTFSAQPNRELRGVIIAVVVALNDETEDDDYQLPDVMEVQAQIHKLDHHKCTNTLHLSGVPRTNNDQLHICRYSAFHPLVTMLKDGYTIQVIKRNPPIKQGVELKMHGIHLVYEGDDDLEGRENTLPEAQQTVSQKLANFFSSFEEGEASAKGDSTVA

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
39-189 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GAVVSNPRSRVKWDAFLSFQRDTSHNFTDRLYEALVKEELRVWNDDLERVDHDHDHELRPSLVEAIEDSVAFVVVLSPNYANSHLRLEELAKLCDLKCLMVPIFYKVEPREVKEQNGPFEKDFEEHSKRFGEEKIQRWKGAMTTVGNISGF

Gene3D: G3DSA:3.40.50.10140
47-183 G3DSA:3.40.50.10140

SRVKWDAFLSFQRDTSHNFTDRLYEALVKEELRVWNDDLERVDHDHDHELRPSLVEAIEDSVAFVVVLSPNYANSHLRLEELAKLCDLKCLMVPIFYKVEPREVKEQNGPFEKDFEEHSKRFGEEKIQRWKGAMTTV

ProfileScan: PS50104
IPR000157
49-186 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VKWDAFLSFQRDTSHNFTDRLYEALVKEELRVWNDDLERVDHDHDHELRPSLVEAIEDSVAFVVVLSPNYANSHLRLEELAKLCDLKCLMVPIFYKVEPREVKEQNGPFEKDFEEHSKRFGEEKIQRWKGAMTTVGNI

HMMSmart: SM00255
IPR000157
50-186 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KWDAFLSFQRDTSHNFTDRLYEALVKEELRVWNDDLERVDHDHDHELRPSLVEAIEDSVAFVVVLSPNYANSHLRLEELAKLCDLKCLMVPIFYKVEPREVKEQNGPFEKDFEEHSKRFGEEKIQRWKGAMTTVGNI

HMMPfam: PF01582
IPR000157
53-180 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AFLSFQRDTSHNFTDRLYEALVKEELRVWNDDLERVDHDHDHELRPSLVEAIEDSVAFVVVLSPNYANSHLRLEELAKLCDLKCLMVPIFYKVEPREVKEQNGPFEKDFEEHSKRFGEEKIQRWKGAM

superfamily: SSF52200
IPR000157
198-351 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EMETGVVPNRLKYSVFLSFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMNLVGNIPGY

Gene3D: G3DSA:3.40.50.10140
207-343 G3DSA:3.40.50.10140

RLKYSVFLSFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMN

ProfileScan: PS50104
IPR000157
208-348 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LKYSVFLSFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMNLVGNI

HMMSmart: SM00255
IPR000157
209-348 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYSVFLSFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMNLVGNI

HMMPfam: PF01582
IPR000157
212-343 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMN

HMMPanther: PTHR23155
216-1377 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMNLVGNIPGYVCTAKTVGDDNEGINREKVDDMIDLVVKKVVAAVRNRPEIVADYTVGLESPIKDLMKLFNTESSSGIQVMGLYGMGGIGKTTLAKAFYNKIIVNFNRHRVFIESVRGKSSDQDGLVNLQKTLIKELFRLVPEIEDVSIGLEKIKENVHEKKIIVVLDDVDHIDQVNALVGETSWYGEGSLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSFYSLRKEKPPTQGLLELSKKIAEVTGLLPLAVKVFGSHFYDKDENEWQVELEKLKTQQDKLHGVLALSFKSLDEEEKKIFLDIACLFLKMDITKEEVVDILKGCGLNAEAALRVLIQKSLLTILTDDTLWMHDQIRDMGRQMVHKESSDDPEMRSRLWDRGEIMNVLDYMKGTSSIRGIVLDFNKKFARDHTADEIFSSNLRNNPGIYSVFNYLKNKLVRFPAEEKPKRSEITIPVESFAPMKKLRLLQINNVELEGDLKLLPSELKWIQWKGFPLENLPPDILSRQLGVLDLSESGVRRVKTLPRKRGDENLKVVNLRGCHGLEAIPDLSNHNALEKLVLERCNLLVKVPRSVGNLGKLLQLDLRRCSSLSEFLGDVSGLKCLEKFFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPYSIFRLQKLEKLSLMGCRSIEELPSCVGYLTSLEDLYLDDTALRNLPSSIGDLKNLQKLHLMRCTSLSTIPETINKLMSLKELFINGSAVEELPIETGSLLCLTDLSAGDCKFLKQVPSSIGGLNSLLQLQLDSTPIEALPEEIGDLHFIRQLDLRNCKSLKALPKTIGKMDTLYSLNLVGSNIEELPEEFGKLENLVELRMNNCKMLKRLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMVLEMLKKPLFRISESNVPGTSEEPRFVEVPNSFSKLLKLEELDACSWRISGKIPDDLEKLSCLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANCFSLESVSDLSELTILTDLNLTNCAKVVDI

HMMPanther: PTHR23155:SF302
216-1377 PTHR23155:SF302

FRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILSTNYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEETIQRWKRAMNLVGNIPGYVCTAKTVGDDNEGINREKVDDMIDLVVKKVVAAVRNRPEIVADYTVGLESPIKDLMKLFNTESSSGIQVMGLYGMGGIGKTTLAKAFYNKIIVNFNRHRVFIESVRGKSSDQDGLVNLQKTLIKELFRLVPEIEDVSIGLEKIKENVHEKKIIVVLDDVDHIDQVNALVGETSWYGEGSLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSFYSLRKEKPPTQGLLELSKKIAEVTGLLPLAVKVFGSHFYDKDENEWQVELEKLKTQQDKLHGVLALSFKSLDEEEKKIFLDIACLFLKMDITKEEVVDILKGCGLNAEAALRVLIQKSLLTILTDDTLWMHDQIRDMGRQMVHKESSDDPEMRSRLWDRGEIMNVLDYMKGTSSIRGIVLDFNKKFARDHTADEIFSSNLRNNPGIYSVFNYLKNKLVRFPAEEKPKRSEITIPVESFAPMKKLRLLQINNVELEGDLKLLPSELKWIQWKGFPLENLPPDILSRQLGVLDLSESGVRRVKTLPRKRGDENLKVVNLRGCHGLEAIPDLSNHNALEKLVLERCNLLVKVPRSVGNLGKLLQLDLRRCSSLSEFLGDVSGLKCLEKFFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPYSIFRLQKLEKLSLMGCRSIEELPSCVGYLTSLEDLYLDDTALRNLPSSIGDLKNLQKLHLMRCTSLSTIPETINKLMSLKELFINGSAVEELPIETGSLLCLTDLSAGDCKFLKQVPSSIGGLNSLLQLQLDSTPIEALPEEIGDLHFIRQLDLRNCKSLKALPKTIGKMDTLYSLNLVGSNIEELPEEFGKLENLVELRMNNCKMLKRLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMVLEMLKKPLFRISESNVPGTSEEPRFVEVPNSFSKLLKLEELDACSWRISGKIPDDLEKLSCLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANCFSLESVSDLSELTILTDLNLTNCAKVVDI

superfamily: SSF52540
375-620 SSF52540

DLVVKKVVAAVRNRPEIVADYTVGLESPIKDLMKLFNTESSSGIQVMGLYGMGGIGKTTLAKAFYNKIIVNFNRHRVFIESVRGKSSDQDGLVNLQKTLIKELFRLVPEIEDVSIGLEKIKENVHEKKIIVVLDDVDHIDQVNALVGETSWYGEGSLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSFYSLRKEKPPTQGLLELSKKIAEVTGLLPLAVKVFGSHFYDKDENEWQVELEKL

Gene3D: G3DSA:3.40.50.300
388-544 G3DSA:3.40.50.300

RPEIVADYTVGLESPIKDLMKLFNTESSSGIQVMGLYGMGGIGKTTLAKAFYNKIIVNFNRHRVFIESVRGKSSDQDGLVNLQKTLIKELFRLVPEIEDVSIGLEKIKENVHEKKIIVVLDDVDHIDQVNALVGETSWYGEGSLIVITTRDSEILSK

HMMPfam: PF00931
IPR002182
408-672 NB-ARC,NBS
NB-ARC

KLFNTESSSGIQVMGLYGMGGIGKTTLAKAFYNKIIVNFNRHRVFIESVRGKSSDQDGLVNLQKTLIKELFRLVPEIEDVSIGLEKIKENVHEKKIIVVLDDVDHIDQVNALVGETSWYGEGSLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSFYSLRKEKPPTQGLLELSKKIAEVTGLLPLAVKVFGSHFYDKDENEWQVELEKLKTQQDKLHGVLALSFKSLDEEEKKIFLDIACLFLKMDITKEEVVDILKGCGL

FPrintScan: PR00364
IPR000767
420-435 DISEASERSIST
Disease resistance protein

VMGLYGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
497-511 DISEASERSIST
Disease resistance protein

NVHEKKIIVVLDDVD

FPrintScan: PR00364
IPR000767
591-605 DISEASERSIST
Disease resistance protein

TGLLPLAVKVFGSHF

superfamily: SSF46785
625-734 SSF46785

DKLHGVLALSFKSLDEEEKKIFLDIACLFLKMDITKEEVVDILKGCGLNAEAALRVLIQKSLLTILTDDTLWMHDQIRDMGRQMVHKESSDDPEMRSRLWDRGEIMNVLD

superfamily: SSF52058
696-1122 SSF52058,LRR

WMHDQIRDMGRQMVHKESSDDPEMRSRLWDRGEIMNVLDYMKGTSSIRGIVLDFNKKFARDHTADEIFSSNLRNNPGIYSVFNYLKNKLVRFPAEEKPKRSEITIPVESFAPMKKLRLLQINNVELEGDLKLLPSELKWIQWKGFPLENLPPDILSRQLGVLDLSESGVRRVKTLPRKRGDENLKVVNLRGCHGLEAIPDLSNHNALEKLVLERCNLLVKVPRSVGNLGKLLQLDLRRCSSLSEFLGDVSGLKCLEKFFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPYSIFRLQKLEKLSLMGCRSIEELPSCVGYLTSLEDLYLDDTALRNLPSSIGDLKNLQKLHLMRCTSLSTIPETINKLMSLKELFINGSAVEELPIETGSLLCLTDLSAGDCKFLKQVPSSIGGLNSLLQLQLDS

Gene3D: G3DSA:3.80.10.10
840-1066 G3DSA:3.80.10.10

FPLENLPPDILSRQLGVLDLSESGVRRVKTLPRKRGDENLKVVNLRGCHGLEAIPDLSNHNALEKLVLERCNLLVKVPRSVGNLGKLLQLDLRRCSSLSEFLGDVSGLKCLEKFFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPYSIFRLQKLEKLSLMGCRSIEELPSCVGYLTSLEDLYLDDTALRNLPSSIGDLKNLQKLHLMRCTSLSTIPETINKLM

FPrintScan: PR00364
IPR000767
921-937 DISEASERSIST
Disease resistance protein

GNLGKLLQLDLRRCSSL

Gene3D: G3DSA:3.80.10.10
1067-1237 G3DSA:3.80.10.10

SLKELFINGSAVEELPIETGSLLCLTDLSAGDCKFLKQVPSSIGGLNSLLQLQLDSTPIEALPEEIGDLHFIRQLDLRNCKSLKALPKTIGKMDTLYSLNLVGSNIEELPEEFGKLENLVELRMNNCKMLKRLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMVLEM

superfamily: SSF52047
1104-1479 SSF52047,LRR

QVPSSIGGLNSLLQLQLDSTPIEALPEEIGDLHFIRQLDLRNCKSLKALPKTIGKMDTLYSLNLVGSNIEELPEEFGKLENLVELRMNNCKMLKRLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMVLEMLKKPLFRISESNVPGTSEEPRFVEVPNSFSKLLKLEELDACSWRISGKIPDDLEKLSCLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANCFSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKKRLSKASLKMMRNLSLPGNRVPDWFSQGPVTFSAQPNRELRGVIIAVVVALNDETEDDDYQLPDVMEVQAQIHKLD

Gene3D: G3DSA:3.80.10.10
1259-1426 G3DSA:3.80.10.10

FVEVPNSFSKLLKLEELDACSWRISGKIPDDLEKLSCLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANCFSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKKRLSKASLKMMRNLSLPGNRVPD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox