PRGDB00063883 (Zm.27)

From PRG Wiki
Jump to: navigation, search
Zm.27
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 2911357 (AF041043)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays NADPH HC toxin reductase (hm1) mRNA, hm1-W22 allele, complete cds

DNA Sequence

GAATTCTCCAAATCCAATCCCTGTTGCCATGAGAATTTCAGGGGCAGCCATGGCCGAAAAGGAGAGCAACGGAGTGCGGGTGTGCGTCACCGGAGGAGCCGGGTTCATCGGCTCCTGGCTCGTCAGGAAGCTCCTCGAGAAAGGCTACACCGTCCACGCCACCCTGCGGAACACCGGGGACGAGGCGAAGGCGGGGCTGCTGCGTCGGCTGGTCCCCGGCGCAGCGGAGCGGCTGCGGTTGTTCCAGGCCGACCTCTTCGACGCCGCCACCTTCGCGCCGGCGATCGCTGGGTGCCAGTTCGTCTTCCTCGTCGCCACGCCATTCGGGCTCGATAGCGCCGGCTCCCAGTATAAGAGCACGGCGGAAGCTGTGGTGGACGCGGTGCACGCGATCCTCCGGCAATGCGAGGAGTCCAGGACGGTGAAGCGAGTGATCCACACGGCCTCCGTAGCGGCCGCCTCGCCGCTGCTGGAGGAGGAGGTCCCCGCCTCCGGCGTCGGGTACAGAGACTTCATCGACGAATCTTGTTGGACTTCGCTCAACGTTGACTATCCTCTACGAAGCGCACACTTCGACAAGTACATACTGTCGAAGCTGCAGTCGGAGCAAGAGCTCCTGAGCTACAACAACGGCGAGAGTCCGGCGTTCGAGGTGGTGACCCTGCCGCTGGGGCTCGTGGCGGGCGACACGGTCCTCGGCCGCGCCCCGGAGACGGTGGAGAGCGCCGTGGCGCCCGTGTCCCGCAGCGAGCCCTACTTCGGCCTCCTGCGCATACTGCAGCAGCTCCTGGGGTCGCTGCCGCTGGTGCACGTGGACGACGTCTGCGACGCGCTCGTCTTCTGCATGGAGCGGCGCCCCTCCGTCGCCGGCCGCTTCCTCTGCGCCGCCGCGTACCCGACGATCCACGACGTGGTCGCCCACTACGCCAGCAAGTTCCCTCACCTCGACATCTTGAAAGAGACGACGGAGGCGGTGGCGACGGTGCGGCCTGCCCGGGACAGGTTGGGCGAGCTGGGCTTCAAGTACAAGTACGGCATGGAAGAGATTCTGGATAGCAGCGTTGCCTGTGCGGCGAGATTGGGTTCCCTTGACGGATCCAAGCTCGGCCTACAGAAAGGATAAAAGCTCGAAGCTTACTCATAAGCACCATGGGGAACTTGGATTGTTCGCTGTCCACTATACGCGTTCGAAATTTGGAAACTAGACATACTCCAATAAAACAAGAGGTAAAGAAACGGAATTC


Protein sequences

Name Description Sequence
Zm.27 translated coding region predicted by ESTScan from UniGene Zm.27

XNSPNPIPVAMRISGAAMAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAARLGSLDGSKLGLQKG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF78
15-365 OS06G0651100 PROTEIN,OS06G0651100 PROTEIN

GAAMAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAARLGSLD

HMMPanther: PTHR10366
15-365 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

GAAMAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAARLGSLD

superfamily: SSF51735
24-360 NAD(P)-binding Rossmann-fold domains

NGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAAR

Gene3D: G3DSA:3.40.50.720
IPR016040
26-311 no description
NAD(P)-binding domain

VRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYAS

HMMPfam: PF01370
IPR001509
28-286 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERR

Seg: seg
197-208 seg

LSKLQSEQELLS

Seg: seg
255-269 seg

GLLRILQQLLGSLPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox