PRGDB00063884 (Zm.86)

From PRG Wiki
Jump to: navigation, search
Zm.86
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 3668114 (Y15069)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays mRNA for cinnamoyl-CoA reductase

DNA Sequence

GGCACGAGCTCGGCTGCTACGTAGCTATATATAGCTGCAGAACAGTTTTAGTTACCGGACTGTAGGCACACCAAGCTAGATATCCAAGGGGCCCCCCCGGAAACTAGCTAGCTAGGATGCCAACAGCAGAGGCGACGACGCCCGTGCCGCCGGAGCTGTCCTCCGGGCAAGGGCGGACGGTTTGCGTGACCGGAGCTGGAGGGTTCATTGCCTCCTGGCTCGTCAAGCGCCTCCTGGAGAAGGGCTACACAGTCCGCGGCACGGTCAGGAACCCTGTGGATCCAAAGAACGACCACCTGAGGGCCCTTGACGGCGCCGTCGACCGTCTCGTCCTCCTCCGCGCCGACCTGCTGGACCCACAGAGCCTTGCCGAGGCCTTCTCCGGCTGTGACGGCGTCTTCCACGCCGCCTCCCCGGTCACCGATGACCCTGAGATGATGATCGAGCCAGCGATCCGGGGCACGCGCTACGTGATGGCGGCGGCGGACGACGCCGGAGTGAAGCGCGTCGTGTTCACGTCCTCCATCGGCACCGTGTACATGAACCCCTACCGTGACCCCAGCAAGCCTGTGGACGACACCTGCTGGAGCGACCTCGAGTATTGCAAGAACACCCAGAACTGGTACTGCTACGCCAAGACGGTGGCGGAGCAGGGCGCGTGGGAGGTGGCGCGGAAGCGAGGGCTGGACCTGGTGGTGGTGAACCCGGTGCTGGTGCTGGGCCCGCTGCTGCAGCCGACGGTGAACGCCAGCACGGACCACGTGATGAAGTACCTGACGGGGTCGGCCACGACCTACGTGAACGCGGCGCAGGCGTACGTGCACGTCAGGGACGTGGCCGAGGCGCACGTCCGGGTGTACGAGGCGCCCCACGCGCACGGCCGCTACATCTGCGCCGAGAGCACCCTGCACCGCGGCGACCTCTGCCGCGTCCTCGCCAAGCTCTTCCCGGAGTACCCCGTACCCACCAAGTGCAAGGACCAGGTTAACCCTCCGGTGGTAGGATACAAGTTCACCAACCAGAGGCTCAAGGATCTGGGGATGGACTTCGTGCCGGTCCTGCAGTGCCTCTACGAGACGGTCACCAGCCTCCAGGAGAAAGGCATGCTGCCCGTGCTTCCGACAAAACAAGACCATGACCAACTCGGCAAATCATGATCATATTCATATCCCTCGTTGACGATACTAGCTGCTGCTACCACGcatatcatatcatatatataagatatatatatatatagtggattcatatagttaaccttatatatatgtgtgtgtgtgtgtgttattgtgtgttattagtgtgtACAATTAAATGGCAACTCTAATGGGTGCATGCATCTGCATGCATGCTTTCCTGACAAGTGCCACACATGCATGCAATGTATCTCTTTGGACGATTTATATACAATACTCCGTTGCCAAATaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.86 translated coding region predicted by ESTScan from UniGene Zm.86

MPTAEATTPVPPELSSGQGRTVCVTGAGGFIASWLVKRLLEKGYTVRGTVRNPVDPKNDHLRALDGAVDRLVLLRADLLDPQSLAEAFSGCDGVFHAASPVTDDPEMMIEPAIRGTRYVMAAADDAGVKRVVFTSSIGTVYMNPYRDPSKPVDDTCWSDLEYCKNTQNWYCYAKTVAEQXRVGGGAEARAGPGGGEPGAGAGPAAAADGERQHGPRDEVPDGVGHDLRERGAGVRARQGRGRGARPGVRGAPRARPLHLRREHPAPRRPLPRPRQALPGVPRTHQVQGPGXPSGGRIQVHQPEAQGSGDGLRAGPAVPLRDGHQPPGERHAARASDKTRP

Domains

Domain Start-End Description Sequence

Seg: seg
2-13 seg

PTAEATTPVPPE

HMMPanther: PTHR10366
4-179 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

AEATTPVPPELSSGQGRTVCVTGAGGFIASWLVKRLLEKGYTVRGTVRNPVDPKNDHLRALDGAVDRLVLLRADLLDPQSLAEAFSGCDGVFHAASPVTDDPEMMIEPAIRGTRYVMAAADDAGVKRVVFTSSIGTVYMNPYRDPSKPVDDTCWSDLEYCKNTQNWYCYAKTVAEQ

HMMPanther: PTHR10366:SF9
4-179 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

AEATTPVPPELSSGQGRTVCVTGAGGFIASWLVKRLLEKGYTVRGTVRNPVDPKNDHLRALDGAVDRLVLLRADLLDPQSLAEAFSGCDGVFHAASPVTDDPEMMIEPAIRGTRYVMAAADDAGVKRVVFTSSIGTVYMNPYRDPSKPVDDTCWSDLEYCKNTQNWYCYAKTVAEQ

superfamily: SSF51735
18-179 NAD(P)-binding Rossmann-fold domains

QGRTVCVTGAGGFIASWLVKRLLEKGYTVRGTVRNPVDPKNDHLRALDGAVDRLVLLRADLLDPQSLAEAFSGCDGVFHAASPVTDDPEMMIEPAIRGTRYVMAAADDAGVKRVVFTSSIGTVYMNPYRDPSKPVDDTCWSDLEYCKNTQNWYCYAKTVAEQ

Gene3D: G3DSA:3.40.50.720
IPR016040
19-179 no description
NAD(P)-binding domain

GRTVCVTGAGGFIASWLVKRLLEKGYTVRGTVRNPVDPKNDHLRALDGAVDRLVLLRADLLDPQSLAEAFSGCDGVFHAASPVTDDPEMMIEPAIRGTRYVMAAADDAGVKRVVFTSSIGTVYMNPYRDPSKPVDDTCWSDLEYCKNTQNWYCYAKTVAEQ

HMMPfam: PF01370
IPR001509
22-179 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFIASWLVKRLLEKGYTVRGTVRNPVDPKNDHLRALDGAVDRLVLLRADLLDPQSLAEAFSGCDGVFHAASPVTDDPEMMIEPAIRGTRYVMAAADDAGVKRVVFTSSIGTVYMNPYRDPSKPVDDTCWSDLEYCKNTQNWYCYAKTVAEQ

Seg: seg
67-80 seg

AVDRLVLLRADLLD

Seg: seg
183-210 seg

GGGAEARAGPGGGEPGAGAGPAAAADGE

Seg: seg
230-278 seg

RGAGVRARQGRGRGARPGVRGAPRARPLHLRREHPAPRRPLPRPRQALP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox