PRGDB00063885 (Zm.168)

From PRG Wiki
Jump to: navigation, search
Zm.168
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22431 (X52384)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Maize mRNA for putative protein kinase

DNA Sequence

GCAACGATGCCTCGTCCTCTTGCAGCTCTCCTCTCTACCGCTTGCATCCTCTCCTTCTTCATCGCTCTGTTTCCAAGAGCTGCATCATCCCGAGACATCCTACCACTGGGTTCCTCTCTCGTAGTCGAGTCCTACGAATCCAGCACCTTACAATCATCAGACGGGACATTCTCCTCTGGCTTCTACGAAGTCTACACCCATGCCTTCACATTCTCAGTATGGTACTCAAAGACGGAGGCGGCGGCGGCCAACAACAAGACCATCGTGTGGAGCGCAAACCCTGACCGCCCTGTCCATGCCAGGAGGTCGGCTCTAACCCTGCAAAAGGACGGCAACATGGTGCTCACCGACTACGACGGCGCAGCCGTGTGGCGAGCTGATGGCAACAACTTCACCGGCGTCCAGCGTGCTCGGCTCCTGGACACCGGGAACCTCGTCATCGAGGACTCAGGAGGTAACACTGTATGGCAGAGTTTCGATTCCCCAACGGACACTTTCCTGCCGACGCAGCTCATCACTGCTGCGACCAGATTAGTCCCCACAACCCAATCGCGTAGTCCTGGTAACTACATCTTCCGCTTCAGCGACCTCTCAGTGCTGTCGCTTATATACCACGTGCCTCAAGTCTCAGACATATACTGGCCAGACCCTGACCAGAACCTCTACCAGGATGGCCGGAACCAGTATAACAGTACGAGGTTAGGAATGCTTACTGATAGCGGGGTGCTTGCCTCGAGCGACTTCGCTGATGGTCAGGCGCTTGTGGCCTCCGACGTAGGGCCGGGCGTCAAGAGAAGGCTAACTCTTGACCCTGATGGCAATCTCCGTCTGTACAGCATGAACGATTCAGATGGGTCATGGTCAGTTTCAATGGTAGCAATGACCCAGCCTTGCAATATTCACGGTTTGTGTGGTCCTAATGGCATCTGCCACTACTCACCCACACCTACATGTTCGTGCCCACCAGGTTATGCGACGAGGAACCCGGGTAACTGGACTGAAGGCTGTATGGCTATTGTCAACACAACCTGTGACCGCTATGACAAGAGGTCTATGAGATTTGTGCGACTTCCCAATACGGATTTTTGGGGGTCGGATCAGCAACATCTTCTGTCGGTTTCTCTTCGAACTTGTAGGGATATCTGCATCAGTGACTGCACCTGTAAAGGCTTTCAGTATCAGGAAGGCACAGGATCATGCTATCCAAAAGCTTATCTTTTCAGTGGAAGAACCTACCCAACATCTGACGTGCGAACGATATATCTCAAGCTTCCAACAGGGGTCAGTGTTTCAAATGCCCTTATTCCACGTTCCGACGTGTTCGATTCCGTGCCCCGTCGTCTCGACTGCGATCGGATGAACAAAAGCATCAGAGAACCGTTTCCAGATGTGCACAAGACCGGCGGAGGAGAATCGAAATGGTTTTACTTCTATGGGTTCATAGCTGCATTTTTTGTCGTTGAAGTTTCCTTCATTTCGTTTGCGTGGTTCTTTGTTTTGAAGAGAGAACTCAGGCCATCTGAACTATGGGCGTCTGAGAAAGGTTACAAAGCAATGACTAGTAATTTTAGAAGGTACAGCTACAGGGAACTTGTGAAGGCGACCAGAAAATTCAAGGTTGAGCTAGGGAGGGGAGAATCAGGCACTGTGTACAAAGGTGTCCTAGAAGATGATAGGCATGTGGCTGTGAAGAAGCTGGAGAATGTAAGGCAAGGCAAGGAAGTGTTTCAGGCTGAGCTAAGTGTAATTGGGAGGATCAACCACATGAACCTTGTGAGGATATGGGGCTTCTGTTCAGAGGGATCTCATAGGTTGTTGGTCTCCGAATATGTTGAGAATGGATCACTGGCTAACATTTTGTTCAGTGAAGGAGGCAACATCTTATTGGACTGGGAGGGAAGGTTCAACATTGCGTTAGGTGTTGCAAAAGGGTTAGCCTATCTCCACCATGAGTGCTTAGAGTGGGTCATCCACTGTGATGTGAAACCTGAGAACATACTGTTAGACCAAGCTTTTGAGCCCAAGATCACTGACTTTGGGTTGGTGAAGTTGCTGAACAGAGGAGGGTCCACCCAGAACGTATCCCATGTCAGAGGAACGCTAGGTTACATTGCACCTGAGTGGGTTTCCAGCCTCCCGATCACAGCAAAAGTCGATGTATACAGTTATGGGGTTGTGCTACTGGAGCTATTGACAGGCACCAGAGTTTCAGAGTTGGTGGGAGGCACAGATGAGGTGCATAGTATGCTTAGAAAGCTTGTCAGGATGCTTTCTGCCAAACTTGAAGGGGAGGAACAATCGTGGATTGATGGGTATCTGGATTCAAAACTGAATCGTCCAGTCAACTATGTGCAAGCAAGAACACTGATCAAATTGGCGGTCTCCTGCTTGGAGGAAGACAGAAGCAAAAGACCGACTATGGAACATGCAGTCCAGACCCTCCTGTCAGCTGATGACTGAATGGGCAAATAAAACATATGCTACAACAACTTCATTGAGTTGACAATTCACATCTTGATGGAAAAAAAGAAGAAGAAGTCAAAAGGCCAACACTCCAGCCATCCTGTCAGTTGGTTTTGGGTGTTTACCCCTGATATAAATTACCTGTAAACAGTTCTCGTTCCAATTTGTCACTATATGATGTAAGTTGTAGCATGTAATGTATTGAACTTGAACAGTTAGATGCGGACGAG


Protein sequences

Name Description Sequence
Zm.168 translated coding region predicted by ESTScan from UniGene Zm.168

ATMPRPLAALLSTACILSFFIALFPRAASSRDILPLGSSLVVESYESSTLQSSDGTFSSGFYEVYTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITAATRLVPTTQSRSPGNYIFRFSDLSVLSLIYHVPQVSDIYWPDPDQNLYQDGRNQYNSTRLGMLTDSGVLASSDFADGQALVASDVGPGVKRRLTLDPDGNLRLYSMNDSDGSWSVSMVAMTQPCNIHGLCGPNGICHYSPTPTCSCPPGYATRNPGNWTEGCMAIVNTTCDRYDKRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPTGVSVSNALIPRSDVFDSVPRRLDCDRMNKSIREPFPDVHKTGGGESKWFYFYGFIAAFFVVEVSFISFAWFFVLKRELRPSELWASEKGYKAMTSNFRRYSYRELVKATRKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTLLSADD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-818 FAMILY NOT NAMED,FAMILY NOT NAMED

ATMPRPLAALLSTACILSFFIALFPRAASSRDILPLGSSLVVESYESSTLQSSDGTFSSGFYEVYTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITAATRLVPTTQSRSPGNYIFRFSDLSVLSLIYHVPQVSDIYWPDPDQNLYQDGRNQYNSTRLGMLTDSGVLASSDFADGQALVASDVGPGVKRRLTLDPDGNLRLYSMNDSDGSWSVSMVAMTQPCNIHGLCGPNGICHYSPTPTCSCPPGYATRNPGNWTEGCMAIVNTTCDRYDKRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPTGVSVSNALIPRSDVFDSVPRRLDCDRMNKSIREPFPDVHKTGGGESKWFYFYGFIAAFFVVEVSFISFAWFFVLKRELRPSELWASEKGYKAMTSNFRRYSYRELVKATRKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTLLSAD

HMMPanther: PTHR24420:SF573
1-818 OS11G0132900 PROTEIN

ATMPRPLAALLSTACILSFFIALFPRAASSRDILPLGSSLVVESYESSTLQSSDGTFSSGFYEVYTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITAATRLVPTTQSRSPGNYIFRFSDLSVLSLIYHVPQVSDIYWPDPDQNLYQDGRNQYNSTRLGMLTDSGVLASSDFADGQALVASDVGPGVKRRLTLDPDGNLRLYSMNDSDGSWSVSMVAMTQPCNIHGLCGPNGICHYSPTPTCSCPPGYATRNPGNWTEGCMAIVNTTCDRYDKRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPTGVSVSNALIPRSDVFDSVPRRLDCDRMNKSIREPFPDVHKTGGGESKWFYFYGFIAAFFVVEVSFISFAWFFVLKRELRPSELWASEKGYKAMTSNFRRYSYRELVKATRKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTLLSAD

ProfileScan: PS50927
IPR001480
25-160 BULB_LECTIN
Bulb-type lectin domain

PRAASSRDILPLGSSLVVESYESSTLQSSDGTFSSGFYEVYTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFD

HMMSmart: SM00108
IPR001480
41-162 Bulb-type mannose-specific lectin
Bulb-type lectin domain

VVESYESSTLQSSDGTFSSGFYEVYTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSP

superfamily: SSF51110
IPR001480
65-289 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

YTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITAATRLVPTTQSRSPGNYIFRFSDLSVLSLIYHVPQVSDIYWPDPDQNLYQDGRNQYNSTRLGMLTDSGVLASSDFADGQALVASDVGPGVKRRLTLDPDGNLRLYSMNDSDGSWSV

Gene3D: G3DSA:2.90.10.10
IPR001480
84-220 no description
Bulb-type lectin domain

NNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITAATRLVPTTQSRSPGNYIFRFSDLSVLSLIYHVPQVSDIYWPDPDQN

HMMPfam: PF01453
IPR001480
85-174 B_lectin
Bulb-type lectin domain

NKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITA

HMMPfam: PF00954
IPR000858
265-326 S_locus_glycop
S-locus glycoprotein

RRLTLDPDGNLRLYSMNDSDGSWSVSMVAMTQPCNIHGLCGPNGICHYSPTPTCSCPPGYAT

ProfileScan: PS50026
IPR000742
294-330 EGF_3
Epidermal growth factor-like, type 3

MTQPCNIHGLCGPNGICHYSPTPTCSCPPGYATRNPG

ProfileScan: PS50948
IPR003609
344-426 PAN
Apple-like

CDRYDKRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPT

superfamily: SSF57414
347-401 Hairpin loop containing domain-like

YDKRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCY

HMMSmart: SM00473
IPR003609
349-426 divergent subfamily of APPLE domains
Apple-like

KRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPT

HMMPfam: PF00024
IPR003014
353-403 PAN_1
PAN-1 domain

RFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPK

Gene3D: G3DSA:3.30.200.20
519-611 no description

MTSNFRRYSYRELVKATRKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYV

superfamily: SSF56112
IPR011009
524-812 Protein kinase-like (PK-like)
Protein kinase-like domain

RRYSYRELVKATRKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQ

ProfileScan: PS50011
IPR000719
536-819 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTLLSADD

HMMSmart: SM00220
IPR002290
536-815 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTLL

HMMSmart: SM00219
IPR020635
536-814 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTL

HMMPfam: PF00069
IPR017442
539-813 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQT

PatternScan: PS00107
IPR017441
542-565 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGESGTVYKGVLEDDRHVAVKK

Gene3D: G3DSA:1.10.510.10
613-814 no description

NGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTL

PatternScan: PS00108
IPR008271
656-668 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHCDVKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox