PRGDB00063887 (Zm.305)

From PRG Wiki
Jump to: navigation, search
Zm.305
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 1597722 (U67422)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays CRINKLY4 precursor (cr4) mRNA, complete cds

DNA Sequence

CAGGGGCCTGGTGAAATGCTGCGCAGCGAGGGTGACTGACTGGCCACTCCGCCCGCCGACCCCCGTTTCGTGCTTACTGGCATGCTCGCAGCATAAAGGAATCTTCTCGGAATTAGCCCCCCTTCCTGTGGTCGTGACGGCCCCAAGTTTCAAGACATGGACCATGTGCCGGCTCTAGTTCTTGCCGGGTGCTGCTTCCTGGCCCTGCTGCCTGGCTGGGCCTGTGGCCTTGGCTCCATGTCGTCCATTGCGGTGTCCTATGGGGAGGATGGTCCGGTGTTCTGTGGCCTCAACTCCGACGGCTCCCACCTCGTCGCCTGCTTCGGTGCTGATGCATCTGTCCTGTACGGCGCACCACCCAACATCCCTTTCCTTGGCCTCACGGCAGGGGATGGGTTCGTGTGTGGCCTCCTGCTCGACACCAGGCAGCCATACTGCTGGGGTAGCAACTCCTATGTCAAGAGCGGGGTGCCACAGCCGATGGTTGAGGGCGCAAGGTACTCTGAGCTCAGTGCGGGGGACAACCACCTCTGCGCACTGAGAGCTGCTCAAGATGGGGGTCGTGGTTCCAGTGCTGCTACATCGCTGATTGACTGCTGGGGATACAATATGACCGCCACACATGCTGTTGATGAAGCCGTGTCGACTGTTTCAGCTGGTTCGGTGTTCAATTGTGGCTTGTTTGCTCGGAACAGGACGGTGTTCTGCTGGGGCGACGAGACGGTGAGTGGTGTCGTTGGGCTGGCACCGAGGGATCTGCACTTTCAGTCTATAGGCGCGGGCGGTTACCATGTCTGTGGGGTGTTGGAGAATGCACAGGTGTTCTGCTGGGGCAGGAGCTTGGAGATGCAGCAGGTGGTGCCATCCAGTGCTATCGGTGATGGTGATGTGAACATAGTGCCGATGGATGCAATGAGCACTGTGGTTGGCGGGCGGTTCCATGCTTGTGGCATCAGGAGCCTTGACCACCAAGTGGCTTGCTGGGGCTTCACTCTTCATAACAGTACATCGCCACCAAAAGGGCTGAAGATGTATGCTCTTGTGGCTGGGGATTACTTCACTTGTGGAGTGCCTGCTGAGACTTCGCTGATGCCGAGGTGCTGGGGCAACAGTGGGCCATTGGCATTACCCATGGCCGTACCTCCTGGGATTTGTGTACCTACTGCATGCAGCCATGGGTACTATGAATATGTGAACCATGGTGAAGTTGGCAGCATCAAGGTGTGTAAGCCTGCAAACTCTAGACTCTGCTTGCCCTGTAGTACAGGTTGCCCGGAAGGCTTGTATGAGTCATCTCCTTGCAATGCAACAGCTGACCGTGTTTGCCAGTTTGATTGCTTGAAGTGTGTCACAGATGAGTGCCTGTCATTCTGCTTATCACAGAAGCGGACCAAGAGCCGCAAGTTGATGGCTTTTCAGATGCGCATCTTTGTTGCAGAGATTGTCTTTGCTGTCGTCTTGGTACTCAGCGTGTCAGTAACCACTTGCCTGTATGTCCGGCACAAGCTTCGACATTGCCAATGCTCAAATAGAGAGCTGAGACTGGCTAAGAGCACAGCATACTCTTTCCGGAAGGATAACATGAAGATCCAGCCTGATATGGAGGACTTGAAGATCAGGAGAGCTCAGGAATTCTCCTATGAAGAGTTAGAGCAAGCAACCGGTGGCTTCTCAGAGGATTCACAAGTCGGCAAAGGCAGCTTCTCATGTGTATTCAAGGGCATACTGAGAGATGGGACAGTGGTTGCTGTGAAGCGTGCAATAAAAGCATCAGATGTGAAGAAGAGCTCAAAGGAGTTTCACAACGAACTTGACCTCCTATCCAGGCTCAACCATGCACATTTGCTGAATTTGCTTGGTTACTGCGAGGATGGCAGTGAGAGGCTCTTGGTTTATGAGTTCATGGCTCATGGATCCCTGTACCAGCATCTGCATGGCAAGGATCCAAACTTGAAAAAGCGACTAAACTGGGCAAGGCGGGTCACCATTGCTGTACAGGCTGCTAGGGGAATTGAGTACTTGCATGGCTATGCTTGCCCTCCTGTAATTCACCGGGACATCAAGTCGTCAAACATATTGATTGATGAGGATCACAATGCCCGTGTTGCTGACTTTGGTCTGTCTATATTGGGTCCTGCAGATAGCGGTACCCCACTGTCTGAGCTGCCAGCAGGGACTCTTGGCTACCTTGACCCTGAGTACTACCGTCTCCACTACTTGACTACAAAATCTGATGTCTACAGCTTCGGGGTTGTTCTCCTGGAGATACTAAGTGGCAGGAAAGCGATCGACATGCAGTTCGAGGAGGGGAACATTGTTGAATGGGCAGTACCTCTGATCAAAGCAGGGGACATTTTTGCCATCCTTGATCCAGTCTTATCTCCTCCCTCAGACCTTGAGGCCCTCAAGAAGATTGCTTCTGTGGCATGTAAGTGTGTCAGAATGCGAGGTAAAGATCGGCCTTCCATGGATAAGGTGACGACAGCTCTAGAGCACGCCCTTGCACTGCTGATGGGCAGCCCCTGCATCGAGCAGCCCATTCTACCGACCGAGGTTGTTCTTGGAAGCAGCCGCATGCACAAGGTGTCACAGATGTCCTCTAACCACTCCTGCTCAGAGAACGAGCTTGCTGACGGGGAGGACCAGGGGATCGGGTACAGGGCACCTTCCTGGATAACTTTTCCTAGCGTGACCTCATCACAGAGGAGGAAATCATCTGCATCCGAAGCTGACATCGTTGGTCGAAGGGCCACAGACGGCAGGAACGTCGGGAGCAGCATAGGTGACGGACTGCGGTCACTGGAGGAAGAAATCGCTCCAGCTTCACCACAAGAGAACCTGTACTTGCAGCACAACTTCTGAAGAAATTCAGGAGATGCAGGAACCTGAGCAGCGACTTTCTGCCATTGTTGAGCAGTATTTTAAGTTCGGCCTTTCATGCCCTGTTGAAGTGTTCATACGTTCTATATAATAGCAGCCTAAAAACAGGGAGCTAATTAGTACTGGAAGAATTCTTTTTAGCGTCCAGAAGCATTCATCTGTAGATTCGTATGGTCCCTTTTATTTTCCTGGTACAATTTATCTTCTGGTGGCTGCAGTTGATGGATTATCGTGTATCCTTAGCTTGCAAAACTGGGTAGTTTCCTTAATCCTTCAGATCATCTCTCTGGCTCCCGATGCTGTTTCTGCATCCTAAATGGCAGTAGCTTTGGGAACCAACTGCATGTCTGGGTCGGGTCACCATGTTCAGCATTCTTTCGCTTGTATCCTTGTGGAAGGTTTCTTCAGTTGCTTGATTTGTGATTCGCAGCAACAGGCTGTCTGCCCaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.305 translated coding region predicted by ESTScan from UniGene Zm.305

QGPGEMLRSEGDXLATPPADPRFVLTGMLAAXRNLLGISPPSCGRDGPKFQDMDHVPALVLAGCCFLALLPGWACGLGSMSSIAVSYGEDGPVFCGLNSDGSHLVACFGADASVLYGAPPNIPFLGLTAGDGFVCGLLLDTRQPYCWGSNSYVKSGVPQPMVEGARYSELSAGDNHLCALRAAQDGGRGSSAATSLIDCWGYNMTATHAVDEAVSTVSAGSVFNCGLFARNRTVFCWGDETVSGVVGLAPRDLHFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVVPSSAIGDGDVNIVPMDAMSTVVGGRFHACGIRSLDHQVACWGFTLHNSTSPPKGLKMYALVAGDYFTCGVPAETSLMPRCWGNSGPLALPMAVPPGICVPTACSHGYYEYVNHGEVGSIKVCKPANSRLCLPCSTGCPEGLYESSPCNATADRVCQFDCLKCVTDECLSFCLSQKRTKSRKLMAFQMRIFVAEIVFAVVLVLSVSVTTCLYVRHKLRHCQCSNRELRLAKSTAYSFRKDNMKIQPDMEDLKIRRAQEFSYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALLMGSPCIEQPILPTEVVLGSSRMHKVSQMSSNHSCSENELADGEDQGIGYRAPSWITFPSVTSSQRRKSSASEADIVGRRATDGRNVGSSIGDGLRSLEEEIAPASPQENLYLQHNF

Domains

Domain Start-End Description Sequence

superfamily: SSF50985
IPR009091
77-338 RCC1/BLIP-II
Regulator of chromosome condensation/beta-lactamas

LGSMSSIAVSYGEDGPVFCGLNSDGSHLVACFGADASVLYGAPPNIPFLGLTAGDGFVCGLLLDTRQPYCWGSNSYVKSGVPQPMVEGARYSELSAGDNHLCALRAAQDGGRGSSAATSLIDCWGYNMTATHAVDEAVSTVSAGSVFNCGLFARNRTVFCWGDETVSGVVGLAPRDLHFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVVPSSAIGDGDVNIVPMDAMSTVVGGRFHACGIRSLDHQVACWGFTLHNSTSP

Gene3D: G3DSA:2.130.10.30
IPR009091
118-374 no description
Regulator of chromosome condensation/beta-lactamas

APPNIPFLGLTAGDGFVCGLLLDTRQPYCWGSNSYVKSGVPQPMVEGARYSELSAGDNHLCALRAAQDGGRGSSAATSLIDCWGYNMTATHAVDEAVSTVSAGSVFNCGLFARNRTVFCWGDETVSGVVGLAPRDLHFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVVPSSAIGDGDVNIVPMDAMSTVVGGRFHACGIRSLDHQVACWGFTLHNSTSPPKGLKMYALVAGDYFTCGVPAETSLMPRCWGNSGPL

ProfileScan: PS50050
IPR001368
389-442 TNFR_NGFR_2
TNFR/CD27/30/40/95 cysteine-rich region

ACSHGYYEYVNHGEVGSIKVCKPANSRLCLPCSTGCPEGLYESSPCNATADRVC

HMMSmart: SM00208
IPR001368
409-442 Tumor necrosis factor receptor / nerve growt
TNFR/CD27/30/40/95 cysteine-rich region

CKPANSRLCLPCSTGCPEGLYESSPCNATADRVC

HMMPfam: PF00020
IPR001368
413-442 TNFR_c6
TNFR/CD27/30/40/95 cysteine-rich region

NSRLCLPCSTGCPEGLYESSPCNATADRVC

HMMPanther: PTHR24420
414-905 FAMILY NOT NAMED,FAMILY NOT NAMED

SRLCLPCSTGCPEGLYESSPCNATADRVCQFDCLKCVTDECLSFCLSQKRTKSRKLMAFQMRIFVAEIVFAVVLVLSVSVTTCLYVRHKLRHCQCSNRELRLAKSTAYSFRKDNMKIQPDMEDLKIRRAQEFSYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALLMGSPCIEQPILPTEVVLGSSRMHKVSQMSSNHSCSENELADGEDQGIGYRAPSWITFPSVTSSQRRKS

HMMPanther: PTHR24420:SF840
414-905 SUBFAMILY NOT NAMED

SRLCLPCSTGCPEGLYESSPCNATADRVCQFDCLKCVTDECLSFCLSQKRTKSRKLMAFQMRIFVAEIVFAVVLVLSVSVTTCLYVRHKLRHCQCSNRELRLAKSTAYSFRKDNMKIQPDMEDLKIRRAQEFSYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALLMGSPCIEQPILPTEVVLGSSRMHKVSQMSSNHSCSENELADGEDQGIGYRAPSWITFPSVTSSQRRKS

Seg: seg
485-495 seg

VVLVLSVSVTT

superfamily: SSF56112
IPR011009
529-853 Protein kinase-like (PK-like)
Protein kinase-like domain

KIQPDMEDLKIRRAQEFSYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALLMGSPCIEQPILPTEVV

Gene3D: G3DSA:3.30.200.20
541-620 no description

RAQEFSYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLG

ProfileScan: PS50011
IPR000719
557-835 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALA

HMMSmart: SM00219
IPR020635
557-830 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTAL

HMMSmart: SM00220
IPR002290
557-835 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALA

HMMPfam: PF07714
IPR001245
560-829 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTA

PatternScan: PS00107
IPR017441
563-589 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGSFSCVFKGILRDGTVVAVKRAIK

Gene3D: G3DSA:1.10.510.10
621-833 no description

YCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHA

PatternScan: PS00108
IPR008271
682-694 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKSSNILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox