PRGDB00063888 (Zm.338)

From PRG Wiki
Jump to: navigation, search
Zm.338
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194706327 (BT042243)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0176D18 mRNA, complete cds

DNA Sequence

TTTTTGGGTCGGCCTCCACACGCAAGCCTCGCCAAGTTTTTAAAACCCCCGAGCTGaaaaaaaaaacacaaggtaaaaaaaTATAGGGAGAGAAATCTCTCGCCTCCCGTCGGAGAGTATCGGTGACCGATGTGTCCCGACGGCGGCGGAAGCTGAGGGAGGTCCTGGCGGCGTCGTCAGCTCAGGGGTGGCGCTGTGGCAACCTGCGCGCGCGCGGTTTTGGCTACCGAGAGGCGGGTCGGGCGTCGGCGGGATGGCGGCGTCGCTGaggtggtggtggtcggcggtggtattttcggtggtggtCGGCGTGATCCCGGTTGTCGCCAACACGGAGGGTGATGCTCTATACAGCCTACGACAAAGCCTGAAAGATAACAACAACGTGCTGCAGAGTTGGGATCCAACTCTGGTTAATCCATGTACATGGTTCCATGTTACTTGTAACCCTGATAACAGTGTCATCAGACTTGATCTTGGAAATGCACAACTATCAGGTCCATTGGTGCCACAGCTTGGGCAATTGAAAAATATGCAATATCTGGAACTTTACAGTAACAACATAAGTGGGCCAATACCACCTGAACTGGGGAACTTGACTAACCTGGTCAGTTTGGACCTGTACCTCAACAACTTCACTGGCGGTATTCCTGACACCTTGGGCCAACTATCAAAGTTGCGGTTTCTCCGTCTTAATAACAACAGTCTTTCTGGTCAAATTCCGAAAACCTTGACCAATATCAACACTCTCCAAGTTCTGGATCTATCAAACAACAATCTCTCGGGAGGGGTGCCATCAAGCGGTTCGTTTTCTCTCTTTACACCTATAAGTTTTGCTAACAACCCAAATCTTTGCGGCCCTGGTACTACAAAGCCTTGTCCTGGGGCTCCTCCATTTTCTCCACCCCCTCCATACAATCCCCCAGCACCAACTTCATCAAAAGGCGTGTCCAGCACTGGAGCAGTAGCTGGAGGCGTTGCAGCTGGCACAGCGTTGCTGATCGCAGTGCCTGCTATTGGGTACGCATTGTGGCGGAGGCGAAAACCCGAAGAGCAATTCTTCGATGTCCCTGCCGAGGAGGATCCCGAAGTTCACCTTGGACAGCTCAAGAGGTTCTCGCTGAGAGAGCTGCAAGTCGCCACGGACAATTTTAACAACAGGAATGTCCTGGGAAGAGGCGGTTTTGGAAAGGTGTACAAAGGGAGACTAACGGACGGTTCACTGGTAGCCGTGAAGAGATTGAAGGAGGAACGCACCCCCGGCGGAGAGCTCCAGTTCCAAACGGAGGTTGAACTGATTAGCATGGCGGTGCACAGGAACCTTCTCCGGCTCCGTGGATTCTGCATGACCCCTACAGAGCGGCTGCTAGTGTATCCATACATGGCTAACGGGAGCGTCGCATCGCGCCTTCGAGAACGCGCGCCAAATGAGCCCCCCCTCGAATGGGAAACGAGGGCTCGGATCGCGCTGGGGTCAGCCAGAGGCCTGTCCTACCTGCACGACCACTGCGATCCCAAGATCATCCACCGCGACGTGAAGGCCGCCAACATCCTGCTGGACGAGGACTTCGAAGCCGTCGTGGGTGACTTCGGCCTGGCCAAGCTCATGGACTACAAGGACACCCACGTGACGACCGCCGTCCGTGGGACGATCGGCCACATCGCCCCCGAGTACCTCTCCACGGGGAAGTCCTCCGAGAAGACGGACGTCTTCGGCTACGGGATCATGCTCCTGGAACTCATCACCGGGCAGAGGGCGTTCGACCTCGCTCGTCTCGCGAACGATGACGACGTCATGCTCCTTGACTGGGTGAAGGCGCTGCTGAAGGAGAAGAAGCTGGAGCAGCTGGTGGACCCGGACCTGCAGGGCCGGTACGTGGACCAGGAGGTGGAGTCGCTGATCCAGGTGGCGCTGCTGTGCACGCAGGGCTCCCCGATGGAGCGGCCCAAGATGTCGGAGGTGGCGCGGATGCTGGAGGGCGACGGGCTGGCGGAGCGGTGGGAGCAGTGGCAGAAGGTGGAGGTGATGCGGCAGGAGGCGGAGCTCGCCCCGCGCCACAACGACTGGATCGTCGACTCCACCTACAACCTCAGGGCCGTCGAACTGTCCGGCCCGAGGTAGGGAGGTAGATGATCGCCGTCGGGATCCTTGTCGTCTGTGAATATGACAGCGGATAGGTAGCTTGGTGGTTGGTCCTGTCTTTAATGATAGCTGCGAAACTGTAGATGAAATTGTGTGCTCGTCTTCTGTAACCTGAGTACCTGACATCTCTGACAttttttttCTGATATTAGAGAGCCGTATGACACCAGCC


Protein sequences

Name Description Sequence
Zm.338 translated coding region predicted by ESTScan from UniGene Zm.338

MAASLRWWWSAVVFSVVVGVIPVVANTEGDALYSLRQSLKDNNNVLQSWDPTLVNPCTWFHVTCNPDNSVIRLDLGNAQLSGPLVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLDLYLNNFTGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVPSSGSFSLFTPISFANNPNLCGPGTTKPCPGAPPFSPPPPYNPPAPTSSKGVSSTGAVAGGVAAGTALLIAVPAIGYALWRRRKPEEQFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFNNRNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKAAAEGEEAGAAGGPGPAGPVRGPGGGVADPGGAAVHAGLPDGAAQDVGGGADAGGRRAGGAVGAVAEGGGDAAGGGARXRATTTGSSTPPTTSGPSNCPARGREVDDRRRDPCRL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-521 FAMILY NOT NAMED,FAMILY NOT NAMED

MAASLRWWWSAVVFSVVVGVIPVVANTEGDALYSLRQSLKDNNNVLQSWDPTLVNPCTWFHVTCNPDNSVIRLDLGNAQLSGPLVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLDLYLNNFTGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVPSSGSFSLFTPISFANNPNLCGPGTTKPCPGAPPFSPPPPYNPPAPTSSKGVSSTGAVAGGVAAGTALLIAVPAIGYALWRRRKPEEQFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFNNRNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVK

HMMPanther: PTHR24420:SF351
1-521 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MAASLRWWWSAVVFSVVVGVIPVVANTEGDALYSLRQSLKDNNNVLQSWDPTLVNPCTWFHVTCNPDNSVIRLDLGNAQLSGPLVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLDLYLNNFTGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVPSSGSFSLFTPISFANNPNLCGPGTTKPCPGAPPFSPPPPYNPPAPTSSKGVSSTGAVAGGVAAGTALLIAVPAIGYALWRRRKPEEQFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFNNRNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVK

Seg: seg
12-24 seg

VVFSVVVGVIPVV

superfamily: SSF52058
22-209 L domain-like,LRR

PVVANTEGDALYSLRQSLKDNNNVLQSWDPTLVNPCTWFHVTCNPDNSVIRLDLGNAQLSGPLVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLDLYLNNFTGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVPSSGSFSLFTPISFANNPNLCGPGTTKPC

HMMPfam: PF08263
IPR013210
25-65 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ANTEGDALYSLRQSLKDNNNVLQSWDPTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
27-198 no description

TEGDALYSLRQSLKDNNNVLQSWDPTLVNPCTWFHVTCNPDNSVIRLDLGNAQLSGPLVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLDLYLNNFTGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVPSSGSFSLFTPISFANNP

HMMPfam: PF00560
IPR001611
93-115 LRR_1
Leucine-rich repeat

NMQYLELYSNNISGPIPPELGNL

Seg: seg
139-153 seg

LSKLRFLRLNNNSLS

HMMPfam: PF00560
IPR001611
141-161 LRR_1
Leucine-rich repeat

KLRFLRLNNNSLSGQIPKTLT

HMMPfam: PF00560
IPR001611
166-183 LRR_1
Leucine-rich repeat

LQVLDLSNNNLSGGVPSS

Seg: seg
208-226 seg

PCPGAPPFSPPPPYNPPAP

Gene3D: G3DSA:2.60.120.200
IPR013320
214-318 no description
Concanavalin A-like lectin/glucanase, subgroup

PFSPPPPYNPPAPTSSKGVSSTGAVAGGVAAGTALLIAVPAIGYALWRRRKPEEQFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFNNRNVLGRGGFGKVYKGR

Seg: seg
227-247 seg

TSSKGVSSTGAVAGGVAAGTA

superfamily: SSF56112
IPR011009
272-504 Protein kinase-like (PK-like)
Protein kinase-like domain

VPAEEDPEVHLGQLKRFSLRELQVATDNFNNRNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFD

ProfileScan: PS50011
IPR000719
300-636 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNNRNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKAAAEGEEAGAAGGPGPAGPVRGPGGGVADPGGAAVHAGLPDGAAQDVGGGADAGGRRAGGAVGAVAEGGGDAAGGGARXRATTTGSSTPPTTSGPSNCPARGREVDDRRRDPCRL

HMMSmart: SM00220
IPR002290
300-560 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNNRNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKAAAEGEEAGAAGGPGPAGPVRGPGGGVADPGGAAVHAGL

HMMSmart: SM00219
IPR020635
300-529 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNNRNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKAAAEGEEA

HMMPfam: PF00069
IPR017442
303-510 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

RNVLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLAN

PatternScan: PS00107
IPR017441
306-328 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLTDGSLVAVK

Gene3D: G3DSA:3.30.200.20
319-363 no description

LTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGF

Gene3D: G3DSA:1.10.510.10
364-520 no description

CMTPTERLLVYPYMANGSVASRLRERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWV

PatternScan: PS00108
IPR008271
423-435 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL

Seg: seg
522-559 seg

AAAEGEEAGAAGGPGPAGPVRGPGGGVADPGGAAVHAG

Seg: seg
562-602 seg

DGAAQDVGGGADAGGRRAGGAVGAVAEGGGDAAGGGARXRA

Seg: seg
603-617 seg

TTTGSSTPPTTSGPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox