PRGDB00063889 (Zm.344)

From PRG Wiki
Jump to: navigation, search
Zm.344
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195597216 (EU944862)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Zea mays

Comment?

Zea mays clone 234230 mRNA sequence

DNA Sequence

AATTATTAATGCCATTGAGGTGTTTGAGATAATCCCAGCTGAAAAGAAGACTTTGCCTCAGGAAGTGAGTGCATTGCGAACGTTGAAGGGTTCACTTGGTCTTCCTCTTCGATTTGGCTGGAATGGTGACCCCTGTGTTCCTCAGCAGCATCCATGGAGTGGAGTTGATTGCCAGTTTGACAGCACCAAAGGGAACTGGATCATTGATGGATTAGGTCTTGACAACCAAGGTTTAAAAGGGGTCATACCTAGTGACATATCTAAGTTGCAACATCTACAAAACATAAACTTGAGTGGCAATAGCATAAAGGGGAACATTCCAATCTCCCTGGGTACCATCTCTGTGGTGCAAGTACTGGATCTGTCATACAATGAGCTTAATGGATCTATTCCAGAGAGCCTCGGCGAGCTGACATCATTACAGATACTGAACCTGAATGGCAATCGTCTTTCTGGTCGTGTTCCAGCCAGTTTGGGAGGAAGGCCTCTGCACAGAGCTAGATTTAACTTCACGGACAATGCCGGACTATGTGGAATACCTGGGTTACGTGAGTGTGGCCCTCATCTATCCGTGGCTGCAAAGATCGGCATGGCTTTCGGCGTGCTTTTAGCTATTCTATTCCTAGTTGTATTCGCTGCGTGCTGGTGGAAGAGACGCCAGAACATTCTCCGTGCTAAAAGATTAGCTGCAGCAAGGGAAGCTCCTTATGCAAAATCAAGGACCCAGTTCACCCGCGATGTGCAAATGGCCAAGCATCAACGGACACATGAAAATGCTCGGAGCAGCAACAGTGAAGGCTCGCCACATTTGCTTTCCTAGCTCGGTGAGAATACTGCGACAGTGACTTGGCTTCCATCTATTCTTCAGTTCCTCCTTTGTATGCTCCTCTGCAGTCTTGAAAGACGAAGCTGCTGTACATACTAGCTAGGTCACGAATGGTGTATATACTTGTAttttttttGGTGATCTAGAACTCAGTCCAGGAGAGGGATCAGTCTATCAGATGAGAGAAATTACCCATTTCATCCTACTTACTGTTCTGATTACTGCTGTTGATTTCCaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.344 translated coding region predicted by ESTScan from UniGene Zm.344

XIINAIEVFEIIPAEKKTLPQEVSALRTLKGSLGLPLRFGWNGDPCVPQQHPWSGVDCQFDSTKGNWIIDGLGLDNQGLKGVIPSDISKLQHLQNINLSGNSIKGNIPISLGTISVVQVLDLSYNELNGSIPESLGELTSLQILNLNGNRLSGRVPASLGGRPLHRARFNFTDNAGLCGIPGLRECGPHLSVAAKIGMAFGVLLAILFLVVFAACWWKRRQNILRAKRLAAAREAPYAKSRTQFTRDVQMAKHQRTHENARSSNSEGSPHLLS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
11-220 FAMILY NOT NAMED,FAMILY NOT NAMED

IIPAEKKTLPQEVSALRTLKGSLGLPLRFGWNGDPCVPQQHPWSGVDCQFDSTKGNWIIDGLGLDNQGLKGVIPSDISKLQHLQNINLSGNSIKGNIPISLGTISVVQVLDLSYNELNGSIPESLGELTSLQILNLNGNRLSGRVPASLGGRPLHRARFNFTDNAGLCGIPGLRECGPHLSVAAKIGMAFGVLLAILFLVVFAACWWKRR

superfamily: SSF52058
16-161 L domain-like,LRR

KKTLPQEVSALRTLKGSLGLPLRFGWNGDPCVPQQHPWSGVDCQFDSTKGNWIIDGLGLDNQGLKGVIPSDISKLQHLQNINLSGNSIKGNIPISLGTISVVQVLDLSYNELNGSIPESLGELTSLQILNLNGNRLSGRVPASLGG

Gene3D: G3DSA:3.80.10.10
18-161 no description

TLPQEVSALRTLKGSLGLPLRFGWNGDPCVPQQHPWSGVDCQFDSTKGNWIIDGLGLDNQGLKGVIPSDISKLQHLQNINLSGNSIKGNIPISLGTISVVQVLDLSYNELNGSIPESLGELTSLQILNLNGNRLSGRVPASLGG

HMMPfam: PF13855
92-151 LRR_8,Leucine rich repeat

HLQNINLSGNSIKGNIPISLGTISVVQVLDLSYNELNGSIPESLGELTSLQILNLNGNRL

FPrintScan: PR00019
117-130 LEURICHRPT,Leucine-rich repeat signature

VQVLDLSYNELNGS

FPrintScan: PR00019
138-151 LEURICHRPT,Leucine-rich repeat signature

LTSLQILNLNGNRL

Seg: seg
199-214 seg

AFGVLLAILFLVVFAA

Seg: seg
225-238 seg

RAKRLAAAREAPYA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox