PRGDB00063891 (Zm.382)

From PRG Wiki
Jump to: navigation, search
Zm.382
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 3360288 (AF023164)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Zea mays

Comment?

Zea mays leucine-rich repeat transmembrane protein kinase 1 (ltk1) mRNA, partial cds

DNA Sequence

TTGACCCCAACGATCTTAACGTCCTCAACACGCTCTTCACCAGTCTGAATTCTCCTGGGCAGCTCACAGGTTGGCAGGCGAATGGGGGTGATCCTTGTGGCCAGTCATGGAAGGGCATTACTTGCTCAGGATCAGGGGTCACTAAAATCCAATTACCTAACTTGTCACTCACTGGAAATTTGGCCTACAACATGAATAACTTGGGTTCATTAGTTGAGCTTGACATGAGCCAAAATAACCTTGGCGGTGGAGGTCAAGTACAGTACAATCTTCCCAATATGAAGCTTGAGAAACTCAATCTTGCAGGAAATCAATTTGGTGGAAATTTACCCTACTCAATTTCGACGATGCCTAATCTTAAGTATTTAAACCTTAATCATAACCAACTACAAGGAAACATCAGTGATGTATTTTCCAACCTTTACAGTTTGTCAGAACTGGATCTGTCCTTTAATTCCCTTACTGGTGATCTACCACAAAGTTTCACTGGATTGTCAAGCCTGAAAAAAGTGTATTTGCAGAACAACCAATTTACTGGTAATATCAATGTCTTAGCCAATCTCCCCCTTGAAACTTTGAATGTTGCGAACAACCATTTCACTGGTTGGATTCCTAGTCAGCTTAAGAAGATAAACAGTCTACAGACTGATGGAAATTCTTGGAGCACAGGACCAGCGCCACCTCCACCTCCATACACAGCGCCGCCTCCTCCTCCAAACCATTGGAATGCTGATGGTTCATCAAGTTCATCAAGTTCTGGTGGAAGATCTGGGATAGGTGGTGGAGGTGTAGCAGGAATCATTATATCGTTGCTGGTTGTTGGATCAGTTGTTGCATTTCTTGTGATCAAAAGAAGAAAACGCAAAGCTGCTATGAAAGAACATTTTGAACAGCACCAGCCATTCACTTCCTTCCCTTCAAATGAAGTTAAAGACATGAAGCCTGTCTGCGAGGCCACCACAGTAGACATAGAGTCTTTGGCTTCACCTGCTTCAGTTAATCTGAAACCACCTCCGAAGATAGAACGAAACAAATCATTTGATGATGACGATGATTTTTCAAACAAGCTTGTTGCAAAGAAAAGTAATATAACACCTATAAATGCAACTGTTTATTCAGTTGCAGATCTACAGATGGCAACAGATAGCTTTAGCTTCGACAACCTTGTTGGAGAGGGTACTTTTGGACGTGTTTACAGGGCACAATTCAATGATGGAAAGGTTCTGGCGATCAAGAAATTAGATAGTACTGTGATGCCATTTCAATCATCTGATGACTTTGCTGAACTGGTCTCGAACATTTCAAAATTGCACCATCCGAATCTGAATGAGCTTGTGGGCTATTGCATGGAACATGGCCAGCACTTGCTTGTGTATGATTTCCACAGGAATGGATCACTTCATGATCTACTCCACCTTTCAGATGAGTACAGCAAGCCACTTAGCTGGAACACTCGTATCAAGATCGCACTCGGCTCTGCCCGTGCACTGGAGTACCTTCATGAAATATGTTCTCCATCCATCATCCATAAGAATTTCAAGTCGTCAAACATTTTGCTGGACTCAGAATTCAATCCACACCTTTCAGATGCTGGACTTGCAAGCTTTATTCCTGATGCTGAATTCCAGGCAGCAGAACAAAGTGCCGGATACACTGCCCCAGAAGTGGACATGACCGGTCAGTACACCTTCAAGAGTGATGTCTACAGCTTTGGAGTTGTCATGCTTGAACTATTGACAGGACGTAGACCATTTGACAGCTCTAGACCCAGGTCAGAGCAGTCACTTGTGCGGTGGGCAACACCCCAGCTGCATGACATCGACGCATTGGACAGGATGGTCGATCCTGCACTCAAGGGTCTATACCCAGCCAAATCTCTATCCCGATTTGCTGATGTCCTTGCCCTGTGTGTCCAGCCTGAACCAGAATTCAGGCCACCAATGTCAGAGGTGGTGCAAGCATTGGTTCGACTTGTGCAGAGGGCCAACATGACGAAGAGGATGCTTGATGGGGATACTTCTCGGCGACCAGATGACCTGGACCAAGATTTCATATGACAAGCTGAACTCTTGTCAGATTGTATTTATTTCGTTCGACTAGCGGCCCAAGCAAGAGACATAATCACACAAGAGGAAGAAACAGAACTCTGTCAGCTTCGCCAGTACATAATCACAAGTTTTTCCTGGTAGCAAAGTTGTGCTATATGGTTGTACTGTGTCTACAAAATAGTACCTTGATCTTACGCTAATGGCATATTGTTATAATTCTTTGGTAACTTATATGCAAATCCCCAGATAAACaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.382 translated coding region predicted by ESTScan from UniGene Zm.382

XDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNLAYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWSTGPAPPPPPYTAPPPPPNHWNADGSSSSSSSGGRSGIGGGGVAGIIISLLVVGSVVAFLVIKRRKRKAAMKEHFEQHQPFTSFPSNEVKDMKPVCEATTVDIESLASPASVNLKPPPKIERNKSFDDDDDFSNKLVAKKSNITPINATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDLDQDFI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF463
2-685 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNLAYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWSTGPAPPPPPYTAPPPPPNHWNADGSSSSSSSGGRSGIGGGGVAGIIISLLVVGSVVAFLVIKRRKRKAAMKEHFEQHQPFTSFPSNEVKDMKPVCEATTVDIESLASPASVNLKPPPKIERNKSFDDDDDFSNKLVAKKSNITPINATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDLDQDFI

HMMPanther: PTHR24420
2-685 FAMILY NOT NAMED,FAMILY NOT NAMED

DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNLAYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWSTGPAPPPPPYTAPPPPPNHWNADGSSSSSSSGGRSGIGGGGVAGIIISLLVVGSVVAFLVIKRRKRKAAMKEHFEQHQPFTSFPSNEVKDMKPVCEATTVDIESLASPASVNLKPPPKIERNKSFDDDDDFSNKLVAKKSNITPINATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDLDQDFI

HMMPfam: PF08263
IPR013210
3-43 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

PNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCS

Gene3D: G3DSA:3.80.10.10
8-223 no description

VLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNLAYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWST

superfamily: SSF52058
24-224 L domain-like,LRR

GWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNLAYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWSTG

ProfileScan: PS51450
51-72 LRR,Leucine-rich repeat profile.

QLPNLSLTGNLAYNMNNLGSLV

ProfileScan: PS51450
95-117 LRR,Leucine-rich repeat profile.

KLEKLNLAGNQFGGNLPYSISTM

HMMPfam: PF00560
IPR001611
95-115 LRR_1
Leucine-rich repeat

KLEKLNLAGNQFGGNLPYSIS

HMMSmart: SM00369
IPR003591
117-140 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MPNLKYLNLNHNQLQGNISDVFSN

HMMPfam: PF13855
118-177 LRR_8,Leucine rich repeat

PNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQ

ProfileScan: PS51450
119-141 LRR,Leucine-rich repeat profile.

NLKYLNLNHNQLQGNISDVFSNL

HMMSmart: SM00369
IPR003591
141-164 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LYSLSELDLSFNSLTGDLPQSFTG

ProfileScan: PS51450
143-166 LRR,Leucine-rich repeat profile.

SLSELDLSFNSLTGDLPQSFTGLS

HMMSmart: SM00369
IPR003591
165-195 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLKKVYLQNNQFTGNINVLANLPLETLNV

ProfileScan: PS51450
167-189 LRR,Leucine-rich repeat profile.

SLKKVYLQNNQFTGNINVLANLP

ProfileScan: PS51450
190-210 LRR,Leucine-rich repeat profile.

LETLNVANNHFTGWIPSQLKK

Seg: seg
225-239 seg

PAPPPPPYTAPPPPP

Seg: seg
246-278 seg

GSSSSSSSGGRSGIGGGGVAGIIISLLVVGSVV

Seg: seg
344-356 seg

NKSFDDDDDFSNK

superfamily: SSF56112
IPR011009
354-663 Protein kinase-like (PK-like)
Protein kinase-like domain

SNKLVAKKSNITPINATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRAN

Gene3D: G3DSA:3.30.200.20
359-461 no description

AKKSNITPINATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDF

ProfileScan: PS50011
IPR000719
384-658 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRL

HMMSmart: SM00220
IPR002290
384-656 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALV

HMMSmart: SM00219
IPR020635
384-655 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQAL

HMMPfam: PF07714
IPR001245
386-655 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQAL

PatternScan: PS00107
IPR017441
390-413 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGTFGRVYRAQFNDGKVLAIKK

Gene3D: G3DSA:1.10.510.10
464-655 no description

NGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNILLDSEFNPHLSDAGLASFIPDAEFQAAEQSAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox