PRGDB00063892 (Zm.383)

From PRG Wiki
Jump to: navigation, search
Zm.383
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21213259 (AY109511)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Zea mays

Comment?

Zea mays CL1762_1 mRNA sequence

DNA Sequence

TCAGTCGGATTTGGAGGAGTCGAATAAACAAGGAAACTCCTCCCGGCCCAGAAAGCACTTCACTTGCAACAGTCCCCGTCAGGGAGGGAGCATTGCTGTGCGGGATGGCGATAAGGAAGnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnGCTTCTGGCCTGCTGCTGCATTTGGCCTGGTGGACGGATCTTCACTGCTGCGGACACTGACCCCAACGATCTTAATGTCCTCAATACGCTCTTCACCAGnnnnnnnnnnnnnnnnnnnnTCAGAGCTTGGCGGGCGAATGGCGGTGATCCTTGTGGCCAGTCATGGCAGGGCATTACCTGCTCAGGATCAGGGGTCACTAAAATCCTATTACCAAACTTGTCACTCGCCGGAAATCTGGCCTACAACATGAATAACTTGGGTTCATTAGTTGAGCTTGACTTGAGCCAAAATAACCTTGGCGGTGGAGGCCAAATACAGTACAATCTTCCCAATGTGAAGCTTGAGAAACTCAATCTTGCAGGAAATCAATTTGGTGGAAATTTACCCTACTCAATTTCGACGATGCCTAATCTTAAGTATTTAAACCTTAATCATAACCAACTACAAGGAAACATCACTGATGTATTTTCCAACCTTTATAGTTTGTCAGAGCTGGATCTCTCCTTTAATTCTCTTACTGGTGATCTACCACAAGGTTTCACTGGATTGTCAAGCCTGAAAAGAATGTATTTGCAGAACAACCAATTTACTGGTTATATCAATGTCTTAGCCAACCTTCCCCTTGAAACCCTGAATGTTGGAAACAACCATTTCACTGGTTGGATTCCCAGTCAGCTTAAGGAGATAAACAATCTACAGACCGACGGAAATTCTTGGAGCACAGGACCAGCGCCACCTCCACCTCCATATACAGCGCCTCCTCCTCCAAACCATTGGAATGGCGCGGGTCAGAATGGTGATGGTTCATCAAGTTCTGGTGGAAGAnnnnnnnnnnnnnnnnnnnnnnnAGCAGGAATCATTATATCATTGCTGATTGTTGGATCAGTTGTTGCAnnnnnnctaannnnnnnnnnnnnnnnnnnnnnnATTATGGAAGAACAATTTGAACAGCATCAGCCGTTCACTTCCTTCCCTTCAAATGAAGTTAACGACATGAAGCCTATCTATGAGTCCACCACAGTAGACATAGAGTCTTTGGCTTCACCTGCTTCGATTAATCTGAAACCANNNNNGAAGATAGAACAGAACAAATCATTTGATGACGATGATGANNNNNCAAACAAGACTGCTGCAAATAGAAGTAATATAACACCTATGAAGGCAACTGTTTATTCAGTTGCAGATCTACAGATGGCAACAGATAGCTTCAGCTTCGATAACCTTGTTGGAGAGGGTACTTTTGGACGTGTTTACAGGGCACAGTTCAATGGTGGAAAGGTTCTGGCCATCAAGAAATTAGACATTACTGTGATGCCATTTCAATCGTCTGATGACTTTGCTGAACTGGTCTCGAACATTTCAAAATTGCACCATCCGAATCTGAATGAGCTTGTAGGCTATTGCATGGAACATGGCCAGCACTTGCTTGTGTATGATTTCCATAGGAATGGATCGCTTCATGATCTACGCCACCTTTCAGATGAGTACAGCAAGGCACTTAGCTGGAACTCTCGCATCAAGTTCGCACTCGGCTCTGCCCGTGCACTGGAGTACCTTCATGAAATATGTTCnnnnnnnnnnnnnnnnAAGAATTTCAAGGCATCAAATATTTTGCTGGACTCAGAATTCAATCCACACCTTTCAGATACTGGACTTGCAAGCTTCATTCCTGGTGCTGAATTCCAGGCAGCAGAACAAAGTGCCGGATACACTGCCCCAGAAGTGGACATGACCGGTCAGTACACCCTCAAGAGTGATGTTTACAGCTTTGGAGTTGTCATGCTTGAGCTACTGACAGGACGTAGACCATTTGACAGCTCTAGACCCAGGTCAGAGCAGTCACTTGTGCGGTGGGCAGCACCTCAGCTGCATGACATCGATGCATTGGACAGAATGGTCGATCCTGCACTCAAGGGTCTATACCCAGCCAAATCTCTATCCCGATTTGCTGATGTCCTCGCCCTGTGTGTCCAGCCTGAACCAGAATTCAGGCCACCAATGTCAGAGGTGGTGCAAGCATTGGTTCGACTTGTGCAGAGGGCCAACATGACGAAGAGGATGCTTGATGGAGGAGATACTTCTCGTGGACCAGATGATCAGGACCAATATTTCATATGACAAGCTGAACTCGAGCTTTTCAGCTACCTCTCAGATTGTATTTATCTCGTCTCGTTCCACTAGCGCCCGGCAGAGACATAATCACACAAGTGGAAGAGACAGAACTCTGTC


Protein sequences

Name Description Sequence
Zm.383 translated coding region predicted by ESTScan from UniGene Zm.383

XSRIWRSRINKETPPGPESTSLATVPVREGALLCGMAIRKXXXXXXXXXXXXXXXLLACCCIWPGGRIFTAADTDPNDLNVLNTLFTXXXXXXXXRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSLAGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTGYINVLANLPLETLNVGNNHFTGWIPSQLKEINNLQTDGNSWSTGPAPPPPPYTAPPPPNHWNGAGQNGDGSSSSGGRXXXXXXXXAGIIISLLIVGSVVAXXLXXXXXXXXIMEEQFEQHQPFTSFPSNEVNDMKPIYESTTVDIESLASPASINLKPXXKIEQNKSFDDDDXXXNKTAANRSNITPMKATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSRGPDDQDQYFI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
38-760 FAMILY NOT NAMED,FAMILY NOT NAMED

IRKXXXXXXXXXXXXXXXLLACCCIWPGGRIFTAADTDPNDLNVLNTLFTXXXXXXXXRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSLAGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTGYINVLANLPLETLNVGNNHFTGWIPSQLKEINNLQTDGNSWSTGPAPPPPPYTAPPPPNHWNGAGQNGDGSSSSGGRXXXXXXXXAGIIISLLIVGSVVAXXLXXXXXXXXIMEEQFEQHQPFTSFPSNEVNDMKPIYESTTVDIESLASPASINLKPXXKIEQNKSFDDDDXXXNKTAANRSNITPMKATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSRGPDDQDQYFI

HMMPanther: PTHR24420:SF463
38-760 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IRKXXXXXXXXXXXXXXXLLACCCIWPGGRIFTAADTDPNDLNVLNTLFTXXXXXXXXRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSLAGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTGYINVLANLPLETLNVGNNHFTGWIPSQLKEINNLQTDGNSWSTGPAPPPPPYTAPPPPNHWNGAGQNGDGSSSSGGRXXXXXXXXAGIIISLLIVGSVVAXXLXXXXXXXXIMEEQFEQHQPFTSFPSNEVNDMKPIYESTTVDIESLASPASINLKPXXKIEQNKSFDDDDXXXNKTAANRSNITPMKATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSRGPDDQDQYFI

Seg: seg
41-57 seg

XXXXXXXXXXXXXXXLL

superfamily: SSF52058
72-289 L domain-like,LRR

ADTDPNDLNVLNTLFTXXXXXXXXRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSLAGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTGYINVLANLPLETLNVGNNHFTGWIPSQLKEINNLQT

Seg: seg
87-95 seg

TXXXXXXXX

Gene3D: G3DSA:3.80.10.10
97-295 no description

AWRANGGDPCGQSWQGITCSGSGVTKILLPNLSLAGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTGYINVLANLPLETLNVGNNHFTGWIPSQLKEINNLQTDGNSWS

HMMSmart: SM00369
IPR003591
141-167 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGSLVELDLSQNNLGGGGQIQYNLPNV

HMMPfam: PF13516
143-158 LRR_6,Leucine Rich repeat

SLVELDLSQNNLGGGG

HMMPfam: PF00560
IPR001611
168-188 LRR_1
Leucine-rich repeat

KLEKLNLAGNQFGGNLPYSIS

HMMSmart: SM00369
IPR003591
190-213 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MPNLKYLNLNHNQLQGNITDVFSN

HMMPfam: PF13855
191-250 LRR_8,Leucine rich repeat

PNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQ

HMMSmart: SM00369
IPR003591
214-237 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LYSLSELDLSFNSLTGDLPQGFTG

HMMSmart: SM00369
IPR003591
238-260 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLKRMYLQNNQFTGYINVLAN

Seg: seg
298-311 seg

PAPPPPPYTAPPPP

Seg: seg
321-344 seg

GDGSSSSGGRXXXXXXXXAGIIIS

Seg: seg
354-364 seg

XXLXXXXXXXX

Seg: seg
422-428 seg

DDDDXXX

superfamily: SSF56112
IPR011009
428-737 Protein kinase-like (PK-like)
Protein kinase-like domain

XNKTAANRSNITPMKATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRAN

Gene3D: G3DSA:3.30.200.20
434-521 no description

NRSNITPMKATVYSVADLQMATDSFSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVG

ProfileScan: PS50011
IPR000719
458-732 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRL

HMMSmart: SM00220
IPR002290
458-730 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALV

HMMSmart: SM00219
IPR020635
458-729 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSFDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQAL

HMMPfam: PF07714
IPR001245
460-729 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FDNLVGEGTFGRVYRAQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQAL

PatternScan: PS00107
IPR017441
464-487 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGTFGRVYRAQFNGGKVLAIKK

Gene3D: G3DSA:1.10.510.10
522-729 no description

YCMEHGQHLLVYDFHRNGSLHDLRHLSDEYSKALSWNSRIKFALGSARALEYLHEICSXXXXXKNFKASNILLDSEFNPHLSDTGLASFIPGAEFQAAEQSAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox