PRGDB00063894 (Zm.679)

From PRG Wiki
Jump to: navigation, search
Zm.679
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224030138 (BT067248)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0347C09 mRNA, complete cds

DNA Sequence

CCTCTTTTGGCCGATCTCTCTTCCGTTCCGTTCCGCTCTGCCGCAGCCAATTGCTTCTGCTGTGTCCTTTTCCTCCCAGCGAGCACCTTACCTTACCTCTCTCTCCTCGTTGTTGTGTTGTTGATTGATCCTGGAAGCCGCAGCTCCACAAGCTCCCAAAAAGCAACAACCTTTACCTCGTTGTTCATTGTATCTTCCTTTCTTCCCTGCTTCTGGCTCCGCCGCCGCCGCATCTCTTCTGAAGCTGAACCCGCGACAGCTAACCGCCATTGTTTGCAGGGGAGACAGGAGCGAGCgagagagagagagagagagagagagagagagCTCGCGACAAGGTTTTGCCCGCACCATATCGTCCTCTCCCCGCAAGCTCCAAAAGCCAGGTCCAGGGACTAAATAGAGCAAAGGAAGCCTTTCATCATCGTCGTCATACACTAATCGAACGGGAGAATCGGAGGGAGGGACATACATCACGTTTTTGTGCTCCTCCGAGTCCGTCCTTCTCCAAGATCCCCCATTTTCCTTCTCGTTTCCAACCTCCTCCTCCTTCCTGACCGACCGATGGCGATGGTGTGACGCCGCCGCCCGTCCCCGACACCGCTGCGACCTCAGCATTTCCACACCGTCTCGGTCTGGGTCTGGTCTTCGTCTCCGCCTGCGCCTTCGTTTTGATCCTTAAGCTGAGCTTCCCTTCCCCGAGCGCCACCTCCGCCCGTCCTACCATGGCGCTGGCTTCAATGTGATACGCGGAGGTGCGGTCGGTCGGTCGTGACTCGTGAGGAATAGGAAGAGGGTAGgagaggagaagaagagccagcgccggcgggaggggagatggcgggcggcgagggggagaTGCGGTCGCTGGCGCTCACGCCCACGTGGTCCGTCGCCACCGTGCTCACCCTCCTCGTCGCGGGCTCGCTCCTCATCGAGCGCTCCATCCACCGCCTCAGCAATTGGCTGAAGAAAACTCATCGGAATCCACTTTACAAAGCAATGGAGAAGATGAAAGAAGAAATGATGCTGCTTGGGTTCATATCTCTGCTTCTGGCTGCGACGTCAAGAATCATCTCGGGGATCTGCATCGACTCCAAGTACTACAACAGCAGATTCTCCCCGTGCACCAAAGAAGAGGTCCAAGAATCGATAAATGCAGAGCATGCCATTGCTCACGCGCGCAAGCATCTACTGGAGGTCATCCTGCACCATTCACCGAGGAGAAATCTGAAAACTAGTTACCATAACCATGAAGGCTGCCGTGAGGGATATGAGTCATTTGTTTCGCATGAAGGTTTGGAGCAGCTGCACCGGTTTATATTTGTAATGGCTGTGACTCATGTGACTTATAGCTGCCTGACGATGTTACTAGCAATACTCAAGATCCATAAATGGAGAAAATGGGAGGATGAAGCATTCAGGGATAATCATGAATCATTTTCTCAGATCGCATATGAGTCAGCAACTAGAAGGCAACCAGCACTTACCAAATCCTATTCATTCCGCTCTTGGAGCCAAAATAATGTGGTCATGTGGCTTGTTTGCTTTATTGCGCAATTTGGTCAGTCTGTTGTTCGAGCAGACTATCTTATCCTCCGCAAGGGTTTTATAATGACCCACAATCTTCCGCCAACATATGATTTCCACAATTACATGATACGCTCAATGGAAGAGGAGTTTGAGAAGATTGTCGGAGTGAGTGGACTGTTGTGGGGCTTCGTTGTTGCTTTTATGTTATTTAATGTAGACGGATCCAACCTGTACTTTTGGATAGCAATTCTTCCTGTAACTCTTGTTCTTCTGGTGGGTGCAAAGCTGCAGCATGTGATTGCGACTCTAACAGCAGAGGGCGCAAAGATGAGCACCTACGGGCCAAGGATACAGCCAAGGGATGATCTCTTTTGGTTCAAGAAACCAGAGTTTCTCCTTTGGTTGATACACTTCGTTCTCTTTCAGAATGCCTTCGAGTTGGCTTCGTTCTTCTGGTTCTGGTGGCAATTTGGTTATGATTCATGCTTCATCAAAAACCACCTTTTGGTATATTGCCGCCTTATACTGGGGTTTGCTGGACAGTTCCTGTGCAGTTACAGTACATTACCTGTATATGCGCTGGTCACTCAGATGGGGTCCAAGTACAAGGCTGCGCTGATCCCGCGGAGGATCAGGGAGACCATACATGGGTGGGGAAAAGCGACGAGGAAGAAGCGCCGGCGCCGCCGCGGCGACGACTCGACGGTCCGcacggagacgagcacggtgtgctcgctcacggacgacgacgaagacttcgaagacgacgacgaccaccaccaccacggaccGTCGTACGATACCCCGAGAGCCGGGGGCCGCCCGCCGTACCTGAAGATCGAGACGCATCGTCAGTCGGGCAGCGGGCACGACGGCCCCAGGCCCGGCGGCACCCCGTGCTTCCACCCCAGCGGCAGCGGCAGCGGGCACGCCATGCTCCTGCGGCAGGCCTCCGTCTCCGCGCCGTCGTCGCCGTCGTACCGCGGAGGCAATAACGTGACAAGGTCGGCGTCCATGCCCGGGATCGCCGCGCTGAGGACAACGGGCTCCGGCACGCCGACGCGCGTGAGCCATGAGGAGCCTACTTGATGCGCGCCCGTGCATGCCATGGATGGCTTGCTAGTGCAGACGTACTGAGGACTGAGCTGCTAGTGTAGCACCGGATTTGAAGGtatatcgatatatatataCACACGAAAAGATTTGGGGTGAC


Protein sequences

Name Description Sequence
Zm.679 translated coding region predicted by ESTScan from UniGene Zm.679

MAGGEGEMRSLALTPTWSVATVLTLLVAGSLLIERSIHRLSNWLKKTHRNPLYKAMEKMKEEMMLLGFISLLLAATSRIISGICIDSKYYNSRFSPCTKEEVQESINAEHAIAHARKHLLEVILHHSPRRNLKTSYHNHEGCREGYESFVSHEGLEQLHRFIFVMAVTHVTYSCLTMLLAILKIHKWRKWEDEAFRDNHESFSQIAYESATRRQPALTKSYSFRSWSQNNVVMWLVCFIAQFGQSVVRADYLILRKGFIMTHNLPPTYDFHNYMIRSMEEEFEKIVGVSGLLWGFVVAFMLFNVDGSNLYFWIAILPVTLVLLVGAKLQHVIATLTAEGAKMSTYGPRIQPRDDLFWFKKPEFLLWLIHFVLFQNAFELASFFWFWWQFGYDSCFIKNHLLVYCRLILGFAGQFLCSYSTLPVYALVTQMGSKYKAALIPRRIRETIHGWGKATRKKRRRRRGDDSTVRTETSTVCSLTDDDEDFEDDDDHHHHGPSYDTPRAGGRPPYLKIETHRQSGSGHDGPRPGGTPCFHPSGSGSGHAMLLRQASVSAPSSPSYRGGNNVTRSASMPGIAALRTTGSGTPTRVSHEEPTXCAPVHAMDGLLVQTY

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
7-470 Mlo
Mlo-related protein

EMRSLALTPTWSVATVLTLLVAGSLLIERSIHRLSNWLKKTHRNPLYKAMEKMKEEMMLLGFISLLLAATSRIISGICIDSKYYNSRFSPCTKEEVQESINAEHAIAHARKHLLEVILHHSPRRNLKTSYHNHEGCREGYESFVSHEGLEQLHRFIFVMAVTHVTYSCLTMLLAILKIHKWRKWEDEAFRDNHESFSQIAYESATRRQPALTKSYSFRSWSQNNVVMWLVCFIAQFGQSVVRADYLILRKGFIMTHNLPPTYDFHNYMIRSMEEEFEKIVGVSGLLWGFVVAFMLFNVDGSNLYFWIAILPVTLVLLVGAKLQHVIATLTAEGAKMSTYGPRIQPRDDLFWFKKPEFLLWLIHFVLFQNAFELASFFWFWWQFGYDSCFIKNHLLVYCRLILGFAGQFLCSYSTLPVYALVTQMGSKYKAALIPRRIRETIHGWGKATRKKRRRRRGDDSTVRT

Seg: seg
54-64 seg

KAMEKMKEEMM

Seg: seg
455-462 seg

RKKRRRRR

Seg: seg
480-494 seg

DDDEDFEDDDDHHHH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox