PRGDB00063895 (Zm.681)

From PRG Wiki
Jump to: navigation, search
Zm.681
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223947850 (BT063312)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0051E18 mRNA, complete cds

DNA Sequence

GCCAGGGACGCGGACGCGGCGGCACCGGCAAGCGGCAAGCAATTGTCTCATCTGCTCCACTCCATCTCCATTTAACGCACTCTCCACTCCTTCGCGGCGGGGGTTTAGGCGCACGGCGGCAGGCCAATTAACGCCGCTGCGGCGAGCACCGGGGGGGAAATGGGCGGCGACGGCACGAGGGCGCTGGACCAGACGCCGACGTGGGCCGTGGCCGCCGTCTGCGCTGTCATCGTCGCGGCGTCCATACTCCTCGAGGGCTTCCTCCACCACCTCGGTCAGTTGCTCAACAAGAAGCGGAAGAAGGCGCTGTTTGACGCTCTGGAGAAGGTTAAATCGGAGCTGATGACTCTGGGGTTCATATCGCTGCTGCTGACCGTGACGGGAAGGTACATCGCGCGCATCTGCATCCCGGAGGGAGCCGCAAACACCATGCTGCCCTGCCGCCTGTCCGGTCACTCGGTGGCGGAAGAGCCCAAGGGCCATGGCCGACGGCACCTATCTGAAGATCCAACCAACCTTTTTTCCTGCCGCAAAGGCATGGTGTCGCTTGTTTCAGCCGACGGCATGCATCAGCTGCACATTTTCGTGTTCTTCTTGGCCGTCTTCCATGTTACCTTCAGTTTCTTCACAATGTCCTTGGGTAGAGCAAAGACTCGTATATGGAAGGTGTGGGAAAAGGAAACTTGCTCCCCTCAGTATAATTATTTAAATGACCCCTCAAAGTTCAGGCTTACGCACCAAACATCTTTTGTGAGGCAACATGCAAGTTGTTGGAGCAAAAGCACAATCACGCTCTATTTTGTGAGCTTCTTTAGGCAGTTCTTCAGATCCGTCCGTAAGACAGACTACTTTACTTTGCGACATGGATTCATTTCAGCTCATTTATCTCCGGGGACTAGGTTCAATTTTCGAAAGTACATTAAAAGGTCCTTGGAGGATGATTTCAAGACAGTTGTTGGCATTAGTCCACCACTATGGGCTTCTGCTTTGGCTGTCATGCTGTTCAATGTTCATGGATGGCACAACTTATTCTGGTTCTCTGCAATTCCCCTTGTAGTTATTCTAGCAGTTGGAACAAAGCTGCAGGCTATAATTGCTATGATGGCTATTGAAATTGCAGAGAGGCATACAGTTATCCAAGGCATGCCGGTGGTAAAACTAAGTGATGATCATTTCTGGTTCGGGAAGCCTCGTTTGGTTCTCCACCTCATTCATTTCGCATCATTTCAGAACGCATTTGAAATTACATATTTCTTTTGGATCTGGTACGAATTTGGCCTGAGGTCCTGCTTCCATGACAACTTTGAGTTTATCATTGCAAGAGTCTGCCTTGGGGCTATCGTCCAGTTTATGTGCAGCTACATCACCCTTCCACTCTATGCCCTTGTTTCTCAGATGGGTTCAGAAATGAAGCGAACAATTTTCGACGAGCAGACAGCGAAGGCCCTGAAGAAATGGCACAAGGCCGTGGTGAAGAAGAAACACCACAAGGATTCCTCACACAATTCTTCCGAGACTCCTAGCACTGACACAACAGGACCTGCAGGGGAAGCGGGTGAGTGGCAGCGGCTGCACGAGGTGCCGGTCCGGCACCTCCACCGGTACAAGACCATCGCGCACGTCGGCGGCGTGAGGAGCCCGTTGTCGGACCCGGACTACAGCGACACGGACGACACCGAGCCGCTGTCGTTGCAGACTAGGCACCTGATACCGCCGGCGAAGCAGCGGAGCCTCGACACCGAGCGCGCGGAGGTGCGCGTGAACGTCGTAGAGACAGCGGCGGCGCCAAGCGACGTCCTCCAAGACAGCTTCTCGTTCCCAAGGCTGCTTCCTCCTCGCCATGTGCCGGACAAGTAAAGTGGCCAGCAGTCTGCTTAGTACTACAGACTGTCCTATATAGAGATAGTAGAATAGTAGTTTCAAGTTATAAGTCGATTTGGCTAGTTATACAACTTTTGTTATTTATTTAGATAAAGGCTATGTCTATATAGCAAAAGTTGTAAAACTAGAAAAATCAAAATGATTTATAATTTG


Protein sequences

Name Description Sequence
Zm.681 translated coding region predicted by ESTScan from UniGene Zm.681

XQGRGRGGTGKRQAIVSSAPLHLHLTHSPLLRGGGLGDGGRPINAAAASTGGEMGGDGTRALDQTPTWAVAAVCAVIVAASILLEGFLHHLGQLLNKKRKKALFDALEKVKSELMTLGFISLLLTVTGRYIARICIPEGAANTMLPCRLSGHSVAEEPKGHGRRHLSEDPTNLFSCRKGMVSLVSADGMHQLHIFVFFLAVFHVTFSFFTMSLGRAKTRIWKVWEKETCSPQYNYLNDPSKFRLTHQTSFVRQHASCWSKSTITLYFVSFFRQFFRSVRKTDYFTLRHGFISAHLSPGTRFNFRKYIKRSLEDDFKTVVGISPPLWASALAVMLFNVHGWHNLFWFSAIPLVVILAVGTKLQAIIAMMAIEIAERHTVIQGMPVVKLSDDHFWFGKPRLVLHLIHFASFQNAFEITYFFWIWYEFGLRSCFHDNFEFIIARVCLGAIVQFMCSYITLPLYALVSQMGSEMKRTIFDEQTAKALKKWHKAVVKKKHHKDSSHNSSETPSTDTTGPAGEAGEWQRLHEVPVRHLHRYKTIAHVGGVRSPLSDPDYSDTDDTEPLSLQTRHLIPPAKQRSLDTERAEVRVNVVETAAAPSDVLQDSFSFPRLLPPRHVPDK

Domains

Domain Start-End Description Sequence

Seg: seg
3-12 seg

GRGRGGTGKR

Seg: seg
17-41 seg

SSAPLHLHLTHSPLLRGGGLGDGGR

HMMPfam: PF03094
IPR004326
59-513 Mlo
Mlo-related protein

TRALDQTPTWAVAAVCAVIVAASILLEGFLHHLGQLLNKKRKKALFDALEKVKSELMTLGFISLLLTVTGRYIARICIPEGAANTMLPCRLSGHSVAEEPKGHGRRHLSEDPTNLFSCRKGMVSLVSADGMHQLHIFVFFLAVFHVTFSFFTMSLGRAKTRIWKVWEKETCSPQYNYLNDPSKFRLTHQTSFVRQHASCWSKSTITLYFVSFFRQFFRSVRKTDYFTLRHGFISAHLSPGTRFNFRKYIKRSLEDDFKTVVGISPPLWASALAVMLFNVHGWHNLFWFSAIPLVVILAVGTKLQAIIAMMAIEIAERHTVIQGMPVVKLSDDHFWFGKPRLVLHLIHFASFQNAFEITYFFWIWYEFGLRSCFHDNFEFIIARVCLGAIVQFMCSYITLPLYALVSQMGSEMKRTIFDEQTAKALKKWHKAVVKKKHHKDSSHNSSETPSTDTTG

Seg: seg
69-80 seg

AVAAVCAVIVAA

Seg: seg
267-279 seg

FVSFFRQFFRSVR

Seg: seg
363-374 seg

AIIAMMAIEIAE

Seg: seg
480-497 seg

AKALKKWHKAVVKKKHHK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox