PRGDB00063896 (Zm.683)

From PRG Wiki
Jump to: navigation, search
Zm.683
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224032684 (BT068521)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0277N15 mRNA, complete cds

DNA Sequence

CCACTTCACTGCAGCCCGCCCGGAGCCGCGCCGCGAGAGGAGGGAGGGAATCAGTGAATGGCGGATGGCAGCGGGGAATCGGAGTCGACGGCGCTGGAGTTCACGCCGACGTGGATCGTGGCGGCGGTCTGCTCCCTCATCGTGGTCATCTCCCTCGCAGCCGAGAGGTGCCTGCATTACCTCGGCAAGGTAACCGATTTTCCTTGCGTGCGTTCCTGAGCACCGAAACGCCTCGCTCCTCGTCTCCCTCCTGAATTTAATGCCGCACCTTGGTGGCGTCCACTGTCCACTGGCGACGGCTGGCAGACGTTCAAGGGGAAGAACCAGAAGGCGCTCTTCGAGGCTCTCCTCAAGGTCAAAGAAGAGCTGATGCTTCTGGGGTTCATCTCGCTGCTGCTGACGGTGTTCCAAGGAGTGATGCAGAGGACGTGCATTCCTCCGGGGTGGACCATCTACATGCTCCCATGCCGTAGCGCCAAGGAGCAGGCCGAGCTGAGCCCCACGGAGGCGCACGGCCATGCTGCCGGAATCTTAGGCCTCACCCGCCGGCGTTTGCTTGCCGAGGGCGGGCCTAGGACCCAGCGTTGCCAGAAGAAGGGAGAAGTTCCTTTGTTGTCAGTTGAAGCACTGCATCAGTTGCATATCTTCATTTTCATTCTGGCCATTGCACACGTGATTTTCTGTGTCCTGACTATGCTTCTAGGAAGCGTGAGGATTCGTCAATGGAAACACTGGGAGGATGAGATTCAGAAGGGTGCTACAGACAATGGGCCTAGGAAGGTGACCTATGTGCATCAATCTGAATTTATCAGGGAACATTCCAAGGGCATTGGCAGAGATACCACAATGTTGAGCTGGCTGCATTCTTTTCTCAAGCAGTTTTATGGGTCGGTTACTAAATCAGACTACACTACAATGCGACTTGGCTTCATCACGACACATTGTAGGTCAAACCCAAAATTTGATTTCCACAGGTACATGATGCGAGCTTTGGAGGCTGACTTTAAGAAGGTGGTTGGCATAAGCTGGTACTTGTGGATATTTGTTGTGGTATTCATGTTGCTGAACATCAATGGTTGGCACACATACTTTTGGATCTCTTTCATTCCCCTTCTGCTTCTGTTGGCCGTTGGCACCAAGCTAGAGCATGTCATAACTCAGTTGGCTCAAGAGGTCGCCGAGAAGCACTCCGCAGTAGAGGGCGACTTGGTGGTCAATCCGTCGGATGACCATTTCTGGTTTGGCCGGCCAAAGATCGTCCTGTACCTGATCCACTTCATCCTCTTCCAGAACGCGTTTGAGATCGCATTCTTCTTCTGGATTCTGACTACCTACGGTTTCAACTCCTGCATCATGGACCACGTCCCCTTCATTGTGCCGAGGCTCGTTGTCGGGTAAATCTGCAGACCTTCTGGCTCCTGGCCCCATTTCGCACAGTCGAAGTGCCATCAATATGTTTCAGACTCATGGTGTTAGCCTTGCAGGGCCATCATCCAGCTCCTCTGTAGCTACAGCACCCTGCCTCTGTACGCGATTGTCACGCAGGTGCGTGCCGTTATACTTTGCATGAGTGGTTGAAACATACTGATGGTTTAAACTGTTCTTTTCTTGTTTGCAAAGATGGGGACTTTCTTCAAGAAGGAGATCTTCGATGAGCACGTGCAGCAGAGCCTTCTGGGCTGGGCGCAGAAGGCCAAGAAGAGGAAAGCGCTCAGGAACAATGGCAATGGCAGCAATGGCGCCGCGGCCGGGTCGTCACATCCATCTGCGACTGCGAGGCTCGAACTGATGAGACGAGCTGTCGCTCTTGAAGAAGGCAGTGCCGGTGGCAACGGGAGTGAGGCTAGTGCGGCCGAGCTACACGACACGGGCCCGAAGCTCTGAACGCTGTAGAAAACGCCCGGCAGAGCGTCAGAAGATGCAGTGTTTCTGTACGCGAGCCATATGTCACTATGTCGTGTGGCTGTTTAGCCAGGTGGTGTAGTGTGATACTGCGTATCATGATTTGTATGCTTTTCTGGATTGAGCTTGAAGCGTGTTATGGAGTGGGGAGCTTTGTGT


Protein sequences

Name Description Sequence
Zm.683 translated coding region predicted by ESTScan from UniGene Zm.683

XTSLQPARSRAARGGRESVNGGWQRGIGVDGAGVHADVDRGGGLLPHRGHLPRSREVPALPRQGNRFSLRAFLSTETPPPRLPPEFNAAPWWRPLSTGDGWQTFKGKNQKALFEALLKVKEELMLLGFISLLLTVFQGVMQRTCIPPGWTIYMLPCRSAKEQAELSPTEAHGHAAGILGLTRRRLLAEGGPRTQRCQKKGEVPLLSVEALHQLHIFIFILAIAHVIFCVLTMLLGSVRIRQWKHWEDEIQKGATDNGPRKVTYVHQSEFIREHSKGIGRDTTMLSWLHSFLKQFYGSVTKSDYTTMRLGFITTHCRSNPKFDFHRYMMRALEADFKKVVGISWYLWIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHSAVEGDLVVNPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVGXICRPSGSWPHFAQSKCHQYVSDSWCXPCRAIIQLLCSYSTLPLYAIVTQVRAVILCMSGXNILMVXTVLFLFAKMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALRNNGNGSNGAAAGSSHPSATARLELMRRAVALEEGSAGGNGSEASAAELHDTGPKL

Domains

Domain Start-End Description Sequence

Seg: seg
7-16 seg

ARSRAARGGR

Seg: seg
40-53 seg

RGGGLLPHRGHLPR

HMMPfam: PF03094
IPR004326
103-468 Mlo
Mlo-related protein

TFKGKNQKALFEALLKVKEELMLLGFISLLLTVFQGVMQRTCIPPGWTIYMLPCRSAKEQAELSPTEAHGHAAGILGLTRRRLLAEGGPRTQRCQKKGEVPLLSVEALHQLHIFIFILAIAHVIFCVLTMLLGSVRIRQWKHWEDEIQKGATDNGPRKVTYVHQSEFIREHSKGIGRDTTMLSWLHSFLKQFYGSVTKSDYTTMRLGFITTHCRSNPKFDFHRYMMRALEADFKKVVGISWYLWIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHSAVEGDLVVNPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVGXIC

HMMPfam: PF03094
IPR004326
496-516 Mlo
Mlo-related protein

AIIQLLCSYSTLPLYAIVTQV

HMMPfam: PF03094
IPR004326
537-588 Mlo
Mlo-related protein

LFAKMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALRNNGNGSNGAAAGSSHP

Seg: seg
573-590 seg

NNGNGSNGAAAGSSHPSA

Seg: seg
604-619 seg

EEGSAGGNGSEASAAE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox