PRGDB00063897 (Zm.684)

From PRG Wiki
Jump to: navigation, search
Zm.684
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219888542 (BT056039)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0156H13 mRNA, complete cds

DNA Sequence

GGAAATCCTAGCGCGTCGCTGCTTCCATTACCGCCTCCGCAACCAGCCCGCCGCGCCCCCGAGCGTTTCGTTCCGGGAGCGGCAAGACTGGGACACGCCAGCCCTTTATTTCGAGCTTTCTGCGTGCGGGAGGGGGGTTGACAGGCGATGGCGGCCGAGGGCGAGGCGGCGGCGCTGGAGTTCACACCGACGTGGATCGTCGCGGCGGTCTGCTCTCTCATCGTGCTCCTCTCGCTCGTCGCCGAGCGATGCCTCCACTACCTCGGCAAGACGCTCAAGAGGAAGAACCAGAAGCCGCTCTTCGAGGCGCTGCTCAAGGTCAAAGAAGAGTTGATGCTTCTGGGGTTCATCTCCCTGCTGCTGACGGTGTTCCAGGGGATGATCCGGAGGACGTGCATCCCTGAACGCTGGACATTCCACATGCTGCCATGCGAGAAGCCAGATGAGAAGGCCGGTGAGGCCGCCACCATGGAGCATTTTGTAGGGACGCTTGGCAGGATCGGTAGGCGTCTGTTGCAGGAAGGCACTGCTGGGGCTGAGCAATGCCAGAAGAAGGGAAAAGTTCCACTTTTGTCCCTTGAAGCCATACATCAGCTGCACATTTTCATATTTGTTCTGGCAATCACACATGTTATTTTCAGCGTCACAACTATGCTTTTAGGAGGTGCACAGATACACCAATGGAAACAGTGGGAGAATGGAATTAAAAAAGATGCTCCTGGAAATGGGCCTAAGGTAACCAATGTACATCATCATGAATTTATCAAGAAACGTTTTAAGGGTATTGGCAAAGATTCTATAATATTGAGTTGGCTGCATTCTTTTGGTAAGCAGTTTTATAGATCAGTATCTAAATCAGATTACACCACAATGCGTCTTGGTTTTATCATGACTCACTGCCCTGGAAATCCAAAATTTGATTTCCATAGATACATGGTAAGGGTTTTAGAGGCGGATTTTAAGAAAGTGGTAGGCATAAGCTGGTACTTGTGGGTCTTCGTGGTGATATTTCTGTTGCTGAATGTTAATGGCTGGCACACATACTTTTGGATTGCTTTCCTTCCCCTTATTCTTCTGTTAGCCATTGGCACTAAGCTGGAGCATGTCATAGCTCAGCTAGCCCATGATGTAGCTGAGAAGCACACAGCGGTCGAGGGCGATGTGATCGTAAAACCATCAGATGAACACTTCTGGTTCGGCAAGCCTAGGGTTATCCTTTACCTGATCCACTTCATCCTCTTTCAGAATGCGTTTGAGATTGCGTTTTTCTTCTGGATACTGAGCACTTATGGATTCGACTCGTGCATCATGGGACAAGTTCGTTTTATTGTGCCAAGGCTTGTCATCGGGGTGGTTATTCAGCTTCTCTGCAGCTACAGCACCTTGCCTCTGTATGCAATTGTAACCCAGATGGGGAGCTGCTACAAGAAGGAGATCTTCAACGAGCATGTGCAGCAGGGCGTCCTGGGCTGGGCTCAGAAGGTCAAGATGAAAAAGGGACTGAAGGGAGCTGCATCTGCTAGCAAGGACGAATCGATTACCAATGCCGATTCGGCAGGACCTTCCGTTAAGATTGAAATGGCGAAGGCTGGGGAGGATGTTGAGATCGTTGGAAACACAGGTTGATTGGGACAATAGGGTGCCCGTGTTGTAATGATGTAACAGGTTAATATGCCATCATCTTTTTTTGTAGATACTAGATAGCTTGCTGTGGCAATACCGCAATAGCGGTGAACTAGAGAAGGTGAGTTTGGGCCCGGGAGCCTCATCTGTTATCGGTCCAGTAGGAAGCAAATTCTTATATACGGGATATCGATAAGAAATGAACTAAGAACATGTTCCTGGATTCATTACCACTAAAAATTAGCTAGCTAAAAGCTGTTATTTTTTT


Protein sequences

Name Description Sequence
Zm.684 translated coding region predicted by ESTScan from UniGene Zm.684

XKSXRVAASITASATSPPRPRAFRSGSGKTGTRQPFISSFLRAGGGLTGDGGRGRGGGAGVHTDVDRRGGLLSHRAPLARRRAMPPLPRQDAQEEEPEAALRGAAQGQRRVDASGVHLPAADGVPGDDPEECIPERWTFHMLPCEKPDEKAGEAATMEHFVGTLGRIGRRLLQEGTAGAEQCQKKGKVPLLSLEAIHQLHIFIFVLAITHVIFSVTTMLLGGAQIHQWKQWENGIKKDAPGNGPKVTNVHHHEFIKKRFKGIGKDSIILSWLHSFGKQFYRSVSKSDYTTMRLGFIMTHCPGNPKFDFHRYMVRVLEADFKKVVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAIGTKLEHVIAQLAHDVAEKHTAVEGDVIVKPSDEHFWFGKPRVILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRFIVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMKKGLKGAASASKDESITNADSAGPSVKIEMAKAGEDVEIVGNTG

Domains

Domain Start-End Description Sequence

Seg: seg
3-20 seg

SXRVAASITASATSPPRP

Seg: seg
41-60 seg

LRAGGGLTGDGGRGRGGGAG

Seg: seg
75-89 seg

RAPLARRRAMPPLPR

Seg: seg
99-110 seg

AALRGAAQGQRR

HMMPfam: PF03094
IPR004326
132-519 Mlo
Mlo-related protein

CIPERWTFHMLPCEKPDEKAGEAATMEHFVGTLGRIGRRLLQEGTAGAEQCQKKGKVPLLSLEAIHQLHIFIFVLAITHVIFSVTTMLLGGAQIHQWKQWENGIKKDAPGNGPKVTNVHHHEFIKKRFKGIGKDSIILSWLHSFGKQFYRSVSKSDYTTMRLGFIMTHCPGNPKFDFHRYMVRVLEADFKKVVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAIGTKLEHVIAQLAHDVAEKHTAVEGDVIVKPSDEHFWFGKPRVILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRFIVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMKKGLKGAASASKDESITNADSA

Seg: seg
330-343 seg

LWVFVVIFLLLNVN

Seg: seg
351-362 seg

IAFLPLILLLAI

Seg: seg
496-509 seg

KMKKGLKGAASASK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox