PRGDB00063899 (Zm.686)

From PRG Wiki
Jump to: navigation, search
Zm.686
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238010497 (BT085931)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0086H20 mRNA, complete cds

DNA Sequence

CTCTCGGCTTTGTCTTCGCTAGCCGACCAATTGTTGGGCCGCCGCTAGCAGGAGCCAGGTCGCGCCGACAGCAGCAGTTGGAAGAGGATCCATGGGGAAGGAGGCGACGCTTGCGTTCACGCCCACCTGGGTGGTGGCCATCGTATGCCTCGTCATCGTCTCTATCTCCCTCGCCGCTGAGCGCTCACTCCATTACCTCGGCAAGTATCTGGAGTGTAAGAAGCAGAAAGCGCTTTTTTCAGCTCTACAGAGACTAAAAGAAGAGCTAATGCTTCTCGGATTCATTTCATTCGTCCTGAGTCTCTCCCAAGGTTTTATTGTTAGCATTTGCATTCCAGAAACTTCTACTGACTTCATGCTTCCATGCAATAGAGGCAACTCCAGAGTTGCAGAAGAAGGTGCTAAAATTTGCAACAAAAAGGGTGATGTTCCCTTGCTATCACTGGAGGCATTACATCAGCTGCACATTTTCATATTTGTACTTGGTTTAGTCCATGTTGTGTTCTGCGCTACAACAATATCATTTAGTGGGGCCAAGATGAGAAAGTGGAAGCATTGGGAAACAGAAATTCACAGAGAAGTACATGAGAAGTTGGTTGCAGTACAGCAAGAAAAGAATGAAGGACAAGGGTCATCATTGAGTATTGTTGTGCTACATCGGGAGCACCAGGATGAATTTGTCCACAAGCGGACAAAGGGATTTTGGATGAAGCTCGCTGTTGCAAGCTGGATAACTGCATTCTTGAAGCAATTTCAAGATTCAGTGAGTAAATCAGATTATGAAGCACTTAGATCAGCTTTTGTCGTGGAACACTATCCCGAGAAACCAGATATTGATTTCCACAAATACATGACTCGCGCTGTTGAATATGAGTTTAAAAGAGTTGTTGGTATCAGCTGGTATCTGTGGCTTTTTGTAATCTTATTCCTGCTGCTGAATATAAATGGATGGCACACATACTTCTGGTTGGCTTTCTTGCCTCTATTTCTGTTACTTATTGTTGGTGCCAAACTAGAGCACATTATCACTCGGTTGGCTCAAGAGGCAGCGATATCATTATCAAATAATACAGAGGAAGTTCCGAAAATAAAGCCATGCAAGGACCATTTCTGGTTTCACAAGCCTGAGCTAGTCCTTCATTTGATCCATTTCATCCTGTTCCAGAATTCGTTCGAGATTAGTTTTTTCTTCTGGATTCTGGTATCAGAAGGTTTCGGTTCGTGTATGATGGAACGGAAGCCTTATGTCATTTCCAGACTTGTTATCGGGGTGATCATCGAAGTCATCTGCAGCTATATCACGCTGCCACTATACGCCATCGTGACCCATATGACCGGACAGATCAAGCTGCATGGTTTTGGCTCCCGCGTGCACGAGAGTGTCCATGGCTGGATCGGCTTGAGGAAGAAACCCTTCTCGTTCTGGAAGATTCCCGGCGGTGACCCTAACGCTGATTCCGGCAGGGAGGCCGACGTAACCCGCAGGGTGGCCAAGGAGCGGTCGGGGAGCTCGCGCAGCATGCCGATGGCGCCGGCTGACGAGATCGTCACCGTCGACGACGTCGCGGTGGCTGCAGCTGCCGTTGGCCAAGGACCATAAAATTCCTAGCTAGCAAACACCAGCAGGGAAGGCAGGCAGGCTGCCGAGGTACCGTGCGCAGCGGGTTGATGGGTCGGACGCTGCGGAAAATTCCTCGTGTCGGGAGCAGGCTGG


Protein sequences

Name Description Sequence
Zm.686 translated coding region predicted by ESTScan from UniGene Zm.686

XSRLCLRXPTNCWAAASRSQVAPTAAVGRGSMGKEATLAFTPTWVVAIVCLVIVSISLAAERSLHYLGKYLECKKQKALFSALQRLKEELMLLGFISFVLSLSQGFIVSICIPETSTDFMLPCNRGNSRVAEEGAKICNKKGDVPLLSLEALHQLHIFIFVLGLVHVVFCATTISFSGAKMRKWKHWETEIHREVHEKLVAVQQEKNEGQGSSLSIVVLHREHQDEFVHKRTKGFWMKLAVASWITAFLKQFQDSVSKSDYEALRSAFVVEHYPEKPDIDFHKYMTRAVEYEFKRVVGISWYLWLFVILFLLLNINGWHTYFWLAFLPLFLLLIVGAKLEHIITRLAQEAAISLSNNTEEVPKIKPCKDHFWFHKPELVLHLIHFILFQNSFEISFFFWILVSEGFGSCMMERKPYVISRLVIGVIIEVICSYITLPLYAIVTHMTGQIKLHGFGSRVHESVHGWIGLRKKPFSFWKIPGGDPNADSGREADVTRRVAKERSGSSRSMPMAPADEIVTVDDVAVAAAAVGQGPKIPSXQTPAGKAGRLPRYRAQRVDGSDAAENSSCREQAG

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
34-471 Mlo
Mlo-related protein

KEATLAFTPTWVVAIVCLVIVSISLAAERSLHYLGKYLECKKQKALFSALQRLKEELMLLGFISFVLSLSQGFIVSICIPETSTDFMLPCNRGNSRVAEEGAKICNKKGDVPLLSLEALHQLHIFIFVLGLVHVVFCATTISFSGAKMRKWKHWETEIHREVHEKLVAVQQEKNEGQGSSLSIVVLHREHQDEFVHKRTKGFWMKLAVASWITAFLKQFQDSVSKSDYEALRSAFVVEHYPEKPDIDFHKYMTRAVEYEFKRVVGISWYLWLFVILFLLLNINGWHTYFWLAFLPLFLLLIVGAKLEHIITRLAQEAAISLSNNTEEVPKIKPCKDHFWFHKPELVLHLIHFILFQNSFEISFFFWILVSEGFGSCMMERKPYVISRLVIGVIIEVICSYITLPLYAIVTHMTGQIKLHGFGSRVHESVHGWIGLRKK

Seg: seg
303-316 seg

LWLFVILFLLLNIN

Seg: seg
322-333 seg

FWLAFLPLFLLL

Seg: seg
517-529 seg

VTVDDVAVAAAAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox