PRGDB00063901 (Zm.746)

From PRG Wiki
Jump to: navigation, search
Zm.746
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195647009 (EU970855)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 352297 CBL-interacting serine

DNA Sequence

GTTATCGCAGGGGGCATTAAGCTGCCTGCCTCCGCTGCCGGCCGTGCTACCTAATCGCCGCGCTTGTTTTCCCACCGCCCGATGGCCGCCATCACGCCGCCGACGCAGTCGGAGCCGTCGCCGCAGACGGGGCGCCCGGCCTCGTCTGCCGCCGCCGCGGCCAAGCGTGGAGGGGGCGGGGCTGGTGCCGCCGGCGGGCCGCTGATGGGGAAGTACGAGCTGGGGCGCCTCCTGGGGCACGGCACCTTCGCGAAGGTGTACCACGCGCGGCACGTCGACACGGGGGACAACGTTGCCATCAAGGTGCTCGACAAGGAGAAGGCCGTGAAGAGCGGGCTCGTCCCGCACATCAAGCGCGAGATCGCTGTGCTACGCCGCGTGCGCCACCCGAACATCGTGCACCTGTTCGAGGTTATGGCCACAAAGACTAAGATCTACTTCGTCATGGAGCTCGTCCGCGGCGGCGAGCTCTTCTCCCGCGTCTCCAAGGGCCGACTCAGGGAGGACACCGCGCGCCGCTACTTCCAGCAGCTCGTCTCCGCCGTGGGGTTCTGCCACGCCCGCGGCGTCTTCCACCGCGACCTGAAGCCCGAGAATCTACTCGTCGACGAGCAGGGGAACCTCAAGGTATCGGATTTTGGGCTCTCCGCCGTCGCCGAGCAGTTCCGTCCCGACGGCCTGCTCCACACCTTCTGCGGCACGCCGGCCTATGTGGCCCCCGAAGTGCTCGGCCGCCGCGGGTACGACGGCGCCAAGGCAGACGTGTGGTCGTGCGGTGTCATCCTCTTTGTGCTCATGGCCGGATATCTCCCTTTCCATGACAAAAACATCATGGCCATGTACAAGAAGATTTACAAGGGCGAGTTCCGCTGTGCGAGGTGGTTCTCCAAAGACCTTACCAGCTTGCTGATGCGCATTCTTCACACTAATCCCAACACTCGGATCACTTTGCCGGAGATCATGGAGTCCCGCTGGTTCAAGAAAGGATTCAAGCCTGTCAAGTTCTATATCGAGGATGACCAGCTGCATAACGTTATAGATGACGAAGATGGCCTGTTAGATATGGGACCTGCTGGTCCTGTTCCTCCACCATTGCCACCTCCACCGCCACCTCTACCTCCACCAAAGGTTGATGGTGATGAATCAGGGTCTGACTCAGACTCGTCGATCTCATCCTGCCCTGCTTCAATGTTATCTGATGAGAGCCAAAGGCCCCGTGGCTCTCTACCACGTCCAGCAAGTCTTAATGCCTTTGATATCATATCATTTTCAAGGGGATTTAACTTATCAGGGTTATTTGAGGAGAAAGGGGATGAAGTGAGGTTCATCTCGGCTGAGCCCATGTCAGATATCATAACCAAATTGGAGGACATAGCGAAGCTGAAGAGCTTCAAGTTGCGGAGGAAGGACTGGCGCATCTGCCTGGAGGGTACAAGGGAAGGAGTTAAGGGGCCATTAACAATTGGCGCGGAGATATTTGAACTCACACCTCCCCTTGTAATGGTGGAGGTAAAAAAGAAGGCAGGGGATAATGAAAAGTACGAGAACTTCTGTGACAAGGAATTGAAGCCAGGGATGCAGCACCTTGTCCACCATATGGTCCGAGCTCCAAGTATGCTGCTTACTGATGCCAAGTAGATCGAAAGGCTTTGAACTTAACAACAGCACTTCGCACGGAGCTACTGGTAACAGGCGTGACATTCTGAGCGGCATGAGGCTAGAGGAGACAGTTGAGCACAGCACAGTTGACCAGAAGAGATAGTCGCCGGAACAAAAACCTTGACCAGTTCCACAGCGCTGTAGTTTCGCAGATGATGAGCAGCTCGGCATCTCATGACTGAATAAACGCAATGCCCGCCATGGAGGGAGACTCCGGTGTCTTTCTTGTACCTGAGGTGGTTAAGTTGTTACTCGAATGCTGTGGATCCTGCTGCGGCTAATGAGCGCACAGCCGTTCTGCCTGATGACTGCTTAACAGATGAATACACATGCTTCAATATGTTCTGAAGAACATCATAGCTATCGATATGTATTTCACTGTCAGACGATTGTATTATATATAATTAGTGTGTCGTTTATTAACAGTTAATTTACCTGTAACTTGACTCTGGCATGATTCACATGGCACATTCATGGTTTATCTTTACaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.746 translated coding region predicted by ESTScan from UniGene Zm.746

VIAGGIKLPASAAGRATXSPRLFSHRPMAAITPPTQSEPSPQTGRPASSAAAAAKRGGGGAGAAGGPLMGKYELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWFKKGFKPVKFYIEDDQLHNVIDDEDGLLDMGPAGPVPPPLPPPPPPLPPPKVDGDESGSDSDSSISSCPASMLSDESQRPRGSLPRPASLNAFDIISFSRGFNLSGLFEEKGDEVRFISAEPMSDIITKLEDIAKLKSFKLRRKDWRICLEGTREGVKGPLTIGAEIFELTPPLVMVEVKKKAGDNEKYENFCDKELKPGMQHLVHHMVRAPSMLLTDAKRSKGFELNNSTSHGATGNRRDILSGMRLEEKLSTAQLTRRDSRRNKNLDQFHSAVVSQMMSSSASHDXINAMPAMEGDSGVFLVPEVVKLLLEAVDPAAANERTAVLPDDCLTDEYTCFNMF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343:SF45
28-341 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

MAAITPPTQSEPSPQTGRPASSAAAAAKRGGGGAGAAGGPLMGKYELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWFKKGFKPVKFYIEDDQ

HMMPanther: PTHR24343
28-341 FAMILY NOT NAMED,SERINE/THREONINE KINASE

MAAITPPTQSEPSPQTGRPASSAAAAAKRGGGGAGAAGGPLMGKYELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWFKKGFKPVKFYIEDDQ

Seg: seg
32-43 seg

TPPTQSEPSPQT

Seg: seg
44-67 seg

GRPASSAAAAAKRGGGGAGAAGGP

superfamily: SSF56112
IPR011009
58-389 Protein kinase-like (PK-like)
Protein kinase-like domain

GGGAGAAGGPLMGKYELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWFKKGFKPVKFYIEDDQLHNVIDDEDGLLDMGPAGPVPPPLPPPPPPLPPPKVDGDESGSDSDSS

Gene3D: G3DSA:3.30.200.20
69-168 no description

MGKYELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLRE

HMMPfam: PF00069
IPR017442
72-326 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWF

ProfileScan: PS50011
IPR000719
72-326 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWF

HMMSmart: SM00220
IPR002290
72-326 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWF

HMMSmart: SM00219
IPR020635
72-326 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLRRVRHPNIVHLFEVMATKTKIYFVMELVRGGELFSRVSKGRLREDTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWF

PatternScan: PS00107
IPR017441
78-101 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGTFAKVYHARHVDTGDNVAIK

Gene3D: G3DSA:1.10.510.10
169-374 no description

DTARRYFQQLVSAVGFCHARGVFHRDLKPENLLVDEQGNLKVSDFGLSAVAEQFRPDGLLHTFCGTPAYVAPEVLGRRGYDGAKADVWSCGVILFVLMAGYLPFHDKNIMAMYKKIYKGEFRCARWFSKDLTSLLMRILHTNPNTRITLPEIMESRWFKKGFKPVKFYIEDDQLHNVIDDEDGLLDMGPAGPVPPPLPPPPPPLPP

PatternScan: PS00108
IPR008271
190-202 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VFHRDLKPENLLV

Seg: seg
360-375 seg

PVPPPLPPPPPPLPPP

Seg: seg
378-392 seg

DGDESGSDSDSSISS

ProfileScan: PS50816
IPR018451
410-434 NAF
NAF/FISL domain

PRPASLNAFDIISFSRGFNLSGLFE

HMMPfam: PF03822
IPR004041
411-467 NAF
NAF domain

RPASLNAFDIISFSRGFNLSGLFEEKGDEVRFISAEPMSDIITKLEDIAKLKSFKLR

Seg: seg
597-611 seg

HSAVVSQMMSSSASH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox