PRGDB00063902 (Zm.948)

From PRG Wiki
Jump to: navigation, search
Zm.948
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195612391 (EU955908)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1551638 receptor-like protein kinase mRNA, complete cds

DNA Sequence

ACCTCCTCGTCGTCGTCTTGGCCGCAGCAGCCAGCAGGTCGCGGCCATGgcctccgtctccctcctactctgcctcctcctcctTGTGCCACCTCTCGCCGCCGCCCAGCAGCAGATGTCCTCTTTCTCCGCAAACAACTCGACCTGGAGCCCCACGAACAGCAACCGCATCCTCGTGTCGATCAATCGGGAATTCGCCGCCGGGTTCGTGGCGTCGACCTCTGCTCGGGATCGCTACCACTTCGCCGTCTGGGTCGTCGGCTCCAACTCCACCGACAAGGCTTTCATATGGTACGCCCACGACACAGCCAGCTACTCCCCCTACGAGGGCAACGACACCTCCAAGCTCGCCATCGACGCGGCGGGCCGGCTCACCTGGACTGCCGGCGGGAACAACAACGCCACCATCTGGTCGCTCCCGCCCCCCGCCAACACCACCACCACCCCGGCGGTGCTGCAGCTCAACGATACGGGGAGCCTGGTCTACGGGGCAGCCTGGTCGAGCTTCGCCGAGCCCACCAACACGCTCATGCCGGGGCAGGCCATGCCCAAGGGAGGCAACGACACCACGCTCCAGTCCGTCAACGGCCACTACAGGGTCGTCAACTCCGCCACGCTGCAGTTCAACAATTCCATGATGTACGCCAACATCAGCGGCGGCAGCGCTCTGCTCAATCTCACCGCCGACGGCAAGCTCCAGTTCAGCGGCTCGCAGCTCATCGCCTCCGACCAAGGCACCACCAATCGGGTGCGGCGGCTCACGCTTGACGACGACGGCAACCTGCGCCTCTACAGCCTGGTGCCCAAGACCCGGAAGTGGCTCGTGGTGTGGCAGGTCGTGCAGGAGCTCTGCACCATCCGGGGCACCTGCGCCAACGGCAGAATCTGCGTCCCCGTCGGCGTTGACAGCACCACTTGCGTCTGCCCGCCGGGCTACCGCAACGCCACCCCGACGGACCCCTGCACACCCAAGAAAAGGTACAGCGGCAGGGGCGACGACGACACGTTCGTGCGGATGGACTTCGTCTCCTTCTCCGGGGCCGCCAACTCCTCGGCGTCGGACCCCGGGCCGCTGATGACCAAGCTGACGCCGCAGAACCTGGCGGACTGCGAGAGACTCTGCCGGAGTAACTCCACCTGCGTGGCGTTCGGGTACAAGTTCGGCGGCGACCGGACGTGCCTCCAGTTCACCGGGCTGGTGGACGGGTACTGGTCCCCGGCGACGGAGATGTCGACCTACCTGCGGGTGGTGGCGTCGGACAAGGACAGCAACCCGTTCACGGGGATGACGACCATGATCGAGACGGTGTGCCCCGTGCGGCTGTCGCTGCCGGTGCCGCCGAAGGAGTCGCGGACGACGATCCAGAACGTGGCCATCATCACGGCGCTGTTCGTGGTGGAGCTGCTGGCCGGGGTGCTGTCGTTCTGGGCGTTTCTGCGCAAGTACTCCCAGTACCGGGAGATGGCGCGCACGCTGGGGCTGGAGTACCTCCCCGCCGGCGGGCCCCGGCGGTTCTCGCACGCGGAGCTGAAGCAGGCGACCAAGGACTTCTCCAACGTGGTGGGGCGCGGTGCGTACGGGACGGTGTACCGCGGCGAGCTGCCCGACCGGCGCGCCGTGGCGGTGAAGCAGCTGCAAGGCGTGGGCGGCGGCGAGGCAGAGTTCTGGGCGGAGGTGACCATCATCGCGCGAATGCACCACCTCAACCTGGTGCGCATGTGGGGGTTCTGCGCCGAAAAGGAGCAGCGGATGCTGGTGTACGAGTACGTACCCAACGGGTCGCTGGACAAGTACCTGTTCGCCGGCGGAGGCGGAGGCGGTGGGAGCGGCGAGGAGGATTCGTCCTCTGagcagcagcagcagcagcCGCTGCTGGACCTTCACACCCGTTACCGCATCGCGCTGGGTGTTGCCCGCGCCATCGCCTACCTCCACGAGGAGTGCCTGGAGTGGGTTCTCCACTGCGACATCAAGCCCGAGAACATCCTGCTGGAGGACGACTTCTGCCCCAAGGTGTCCGACTTCGGTCTGTCCAAGCTGACGAGCAAGAAGGAGAAGGTGACCATGTCGCGCATCCGCGGCACCCGCGGGTACATGGCGCCCGAGTGGGTGATCCACCGCGAGCCCATCACGGCCAAGGCCGACGTGTACAGCTTCGGCATGGTCCTGCTGGAGATCGTGTCCGGTCGCCGCAACTACGGGTTCCGGCAGGAGTCGGTGGGCAGTGAGGACTGGTACTTCCCCAAGTGGGCGTACGAGAAGGTGTACGTGGAGCGCCGCATCGACGACATCCTGGACCCCCGCATCGCCGCCACCTACGACGACGCCGCCAGCGTCGCCACCGTGGAGCGCATGGTGAAGACGGCCATGTGGTGCCTGCAGGACCGCGCCGAGATGCGGCCGTCTATGGGGAAAGTGTCCAAGATGCTGGAGGGGTCCGTCGAGATCACGGAGCCCGTCAAGCCAACAATCTTCTGCGTTCAGGACGACTGATGACTACACAAGttttttttCTTTCATTTCCAGATGTGAATTCCCAGTGCCGTCTGCCGTCCACCGTCAATAGAATTTTAGTAGCTGTTCACTTCCACTCTTTGtttttttttttGGTTTGCATAGCAAAAGCTATACTAATCCTTAAGTATTGTGAATCCACCGTCCAGGAATCCGCTAAGTTATTGTTCACATAGTCCACCTTGCACCCATTACCAAATTTGTTTCTAGGCCATaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.948 translated coding region predicted by ESTScan from UniGene Zm.948

XPPRRRLGRSSQQVAAMASVSLLLCLLLLVPPLAAAQQQMSSFSANNSTWSPTNSNRILVSINREFAAGFVASTSARDRYHFAVWVVGSNSTDKAFIWYAHDTASYSPYEGNDTSKLAIDAAGRLTWTAGGNNNATIWSLPPPANTTTTPAVLQLNDTGSLVYGAAWSSFAEPTNTLMPGQAMPKGGNDTTLQSVNGHYRVVNSATLQFNNSMMYANISGGSALLNLTADGKLQFSGSQLIASDQGTTNRVRRLTLDDDGNLRLYSLVPKTRKWLVVWQVVQELCTIRGTCANGRICVPVGVDSTTCVCPPGYRNATPTDPCTPKKRYSGRGDDDTFVRMDFVSFSGAANSSASDPGPLMTKLTPQNLADCERLCRSNSTCVAFGYKFGGXPDVPPVHRAGGRVLVPGDGDVDLPAGGGVGQGQQPVHGDDDHDRDGVPRAAVAAGAAEGVADDDPERGHHHGAVRGGAAGRGAVVLGVSAQVLPVPGDGAHAGAGVPPRRRAPAVLAAELKQATKDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVSKMLEGSVEITEPVKPTIFCVQDD

Domains

Domain Start-End Description Sequence

Seg: seg
10-48 seg

SSQQVAAMASVSLLLCLLLLVPPLAAAQQQMSSFSANNS

HMMPanther: PTHR24420
38-831 FAMILY NOT NAMED,FAMILY NOT NAMED

QQMSSFSANNSTWSPTNSNRILVSINREFAAGFVASTSARDRYHFAVWVVGSNSTDKAFIWYAHDTASYSPYEGNDTSKLAIDAAGRLTWTAGGNNNATIWSLPPPANTTTTPAVLQLNDTGSLVYGAAWSSFAEPTNTLMPGQAMPKGGNDTTLQSVNGHYRVVNSATLQFNNSMMYANISGGSALLNLTADGKLQFSGSQLIASDQGTTNRVRRLTLDDDGNLRLYSLVPKTRKWLVVWQVVQELCTIRGTCANGRICVPVGVDSTTCVCPPGYRNATPTDPCTPKKRYSGRGDDDTFVRMDFVSFSGAANSSASDPGPLMTKLTPQNLADCERLCRSNSTCVAFGYKFGGXPDVPPVHRAGGRVLVPGDGDVDLPAGGGVGQGQQPVHGDDDHDRDGVPRAAVAAGAAEGVADDDPERGHHHGAVRGGAAGRGAVVLGVSAQVLPVPGDGAHAGAGVPPRRRAPAVLAAELKQATKDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVSKMLEGSVEITEPVKPTIFCVQDD

HMMPanther: PTHR24420:SF576
38-831 OS10G0101000 PROTEIN

QQMSSFSANNSTWSPTNSNRILVSINREFAAGFVASTSARDRYHFAVWVVGSNSTDKAFIWYAHDTASYSPYEGNDTSKLAIDAAGRLTWTAGGNNNATIWSLPPPANTTTTPAVLQLNDTGSLVYGAAWSSFAEPTNTLMPGQAMPKGGNDTTLQSVNGHYRVVNSATLQFNNSMMYANISGGSALLNLTADGKLQFSGSQLIASDQGTTNRVRRLTLDDDGNLRLYSLVPKTRKWLVVWQVVQELCTIRGTCANGRICVPVGVDSTTCVCPPGYRNATPTDPCTPKKRYSGRGDDDTFVRMDFVSFSGAANSSASDPGPLMTKLTPQNLADCERLCRSNSTCVAFGYKFGGXPDVPPVHRAGGRVLVPGDGDVDLPAGGGVGQGQQPVHGDDDHDRDGVPRAAVAAGAAEGVADDDPERGHHHGAVRGGAAGRGAVVLGVSAQVLPVPGDGAHAGAGVPPRRRAPAVLAAELKQATKDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVSKMLEGSVEITEPVKPTIFCVQDD

ProfileScan: PS50927
IPR001480
44-176 BULB_LECTIN
Bulb-type lectin domain

SANNSTWSPTNSNRILVSINREFAAGFVASTSARDRYHFAVWVVGSNSTDKAFIWYAHDTASYSPYEGNDTSKLAIDAAGRLTWTAGGNNNATIWSLPPPANTTTTPAVLQLNDTGSLVYGAAWSSFAEPTNT

superfamily: SSF51110
IPR001480
95-247 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

AFIWYAHDTASYSPYEGNDTSKLAIDAAGRLTWTAGGNNNATIWSLPPPANTTTTPAVLQLNDTGSLVYGAAWSSFAEPTNTLMPGQAMPKGGNDTTLQSVNGHYRVVNSATLQFNNSMMYANISGGSALLNLTADGKLQFSGSQLIASDQGT

HMMPfam: PF01453
IPR001480
95-185 B_lectin
Bulb-type lectin domain

AFIWYAHDTASYSPYEGNDTSKLAIDAAGRLTWTAGGNNNATIWSLPPPANTTTTPAVLQLNDTGSLVYGAAWSSFAEPTNTLMPGQAMPK

Seg: seg
141-151 seg

PPPANTTTTPA

Gene3D: G3DSA:2.90.10.10
IPR001480
220-243 no description
Bulb-type lectin domain

GGSALLNLTADGKLQFSGSQLIAS

HMMPfam: PF00954
IPR000858
247-315 S_locus_glycop
S-locus glycoprotein

TTNRVRRLTLDDDGNLRLYSLVPKTRKWLVVWQVVQELCTIRGTCANGRICVPVGVDSTTCVCPPGYRN

ProfileScan: PS50026
IPR000742
281-319 EGF_3
Epidermal growth factor-like, type 3

VQELCTIRGTCANGRICVPVGVDSTTCVCPPGYRNATPT

Seg: seg
417-457 seg

GGGVGQGQQPVHGDDDHDRDGVPRAAVAAGAAEGVADDDPE

Seg: seg
458-479 seg

RGHHHGAVRGGAAGRGAVVLGV

superfamily: SSF56112
IPR011009
488-819 Protein kinase-like (PK-like)
Protein kinase-like domain

GDGAHAGAGVPPRRRAPAVLAAELKQATKDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVSKMLEGSVEITE

Seg: seg
490-509 seg

GAHAGAGVPPRRRAPAVLAA

Gene3D: G3DSA:3.30.200.20
506-576 no description

VLAAELKQATKDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWG

ProfileScan: PS50011
IPR000719
516-825 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVSKMLEGSVEITEPVKPTI

HMMSmart: SM00219
IPR020635
516-811 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVSKML

HMMSmart: SM00220
IPR002290
516-811 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVSKML

HMMPfam: PF00069
IPR017442
520-808 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSSSEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQDRAEMRPSMGKVS

PatternScan: PS00107
IPR017441
522-544 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGRGAYGTVYRGELPDRRAVAVK

Seg: seg
603-623 seg

GGGGGGGSGEEDSSSEQQQQQ

PatternScan: PS00108
IPR008271
653-665 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHCDIKPENILL

Gene3D: G3DSA:1.10.510.10
782-805 no description

TVERMVKTAMWCLQDRAEMRPSMG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox