PRGDB00063904 (Zm.1140)

From PRG Wiki
Jump to: navigation, search
Zm.1140
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219884346 (BT053941)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0058E03 mRNA, complete cds

DNA Sequence

GCCGCATCCACCCTTCTCCCCGTCCTCCTCCTCATCGCCACCGCCACCCAGTGCACCGCAGCCGATTCATTCTCTTCTCAGGACGCTGCCGCCCTCCTCAACCTCTCTGCGGCGGTAGCAGACCCCTCGGGCTACCTCTCCACGCACTGGACTCCGGACACCGCGGTCTGCTCGTGGCCGCGCGTGTCCTGCGACGCCACCGACACACGAGTCATCTCCCTCGACCTCTCCGGCCTCAATCTATCTGGCCCCATCCCCGCCGCCGCGCTCTCCTCTTTCCCGTACCTCCAGTCGCTCAACCTCTCCAACAACATACTCAACTCCACCGCCTTCCCCGACGAGATCATCGCGTCGCTCAAGAGCCTTCGCGTTCTCGACCTCTACAACAACAACCTCACCGGTTCGCTGCCGGCAGCGCTCCCCAACCTCACCGACCTCGTCCACGTCCACCTCGGCGGCAATTTCTTCTCCGGCAGCATCCCGAGGTCCTACGGCCAGTGGAGCCGCATCCGGTACCTGGCCCTCTCCGGGAACGAGCTCACCGGCGAGATACCGGAGGAGCTCGGCAACCTGACGACATTGAGGGAGCTGTACCTCGGCTACTACAACAACTTCACCGGCGGTATACCACCCGAGCTCGGGAGGCTGCGGGCGCTCGTCCGGCTCGACATGGCTAACTGCGGCATCTCCGAGGAGATCCCGCCGGAACTGGCGAACTTGACGTCGCTCGACACTCTGTTTCTTCAGATCAACGCTCTGTCTGGGAGGCTCCCGACGGAGATAGGCGCAATGGGGTCGCTCAAATCGCTCGACCTGTCGAACAACTTGTTCGTCGGGGAGATCCCCGCGAGCTTCGCGTCGCTCAAGAACCTGACCCTGCTGAACCTCTTCCGGAATCGCCTCGCCGGTGAGATTCCCGAGTTCATCGGCGACTTGCCGAACCTCGAGGTTCTGCAGCTGTGGGAGAACAACTTCACAGGCGGGATACCCACGAACCTCGGCGTGGCGGCGACCAGGCTGAGGATCGTTGACGTGAGCACGAACAAGCTCACCGGCGTTCTGCCATCCGAGCTGTGCGCCGGCCAGCGGCTGGAGACGTTCATCGCTCTGGGAAATTCGCTATTCGGCGACGTTCCGGACGGGCTCGCGGGGTGCCCGTCGCTGACGAGGATTCGGCTGGGAGAGAATTTTCTCAACGGGACGATACCTGCAAAGCTGTTCACGTTGCCGAACCTGACGCAGGTAGAGCTGCACAACAATTTGCTCTCCGGCGAGCTCCGGCTGGACGGAGGGAAGGTGTCTTCTTCGATCGGAGAGCTGAGTCTGTTCAACAACCGACTGACCGGCCAGGTGCCTACCGGGATCGGTGGACTCCTGGGATTACAGAAGCTGTTGCTCGCCGGGAACATGTTGTCCGGCGAGCTCCCGCCGGAGGTCGGGAAGCTTCAGCAGCTCTCGAAGGCGGACCTTTCTGGGAACCTGCTCTCCGGAGCGGTACCCCCGGCGATCGGCAGATGCCGTCTGCTCACCTTCCTCGATATCTCGAGCAACAAGGTCTCCGGCAGCATCCCGCCGGAGCTCGGCAGCCTCCGCATCCTCAACTACCTCAACGTTTCCCACAACGCGCTCCAAGGGGAGATTCCGCCTGCCATCGCCGGAATGCAGAGCCTGACAGCCGTGGACTTCTCGTACAACAACCTCTCGGGCGAGGTCCCGTCCACCGGTCAGTTTGGCTACTTCAACGCCACTTCCTTCGCAGGCAACGCTGGCCTCTGCGGGGCGTTCCTCTCCCCGTGCCGCTCCGTGGGCGTGGCGACTTCGGCCCTGGGCTCCCTCTCTTCGACGTCCAAACTCCTGCTCGTGCTCGGCCTCCTCGCGCTGTCCGTCGTCTTcgcgggcgcggccgtgctgaaggcgcggtcgctgaagcggtccgccgaggcgcgcgcgTGGCGGCTGACGGCGTTCCAGCGGCTGGACTTCGCCGTGGACGACGTGCTGGACTGCCTCAAGGAGGAGAACGTGATCGGCAAGGGCGGGTCCGGGATCGTGTACAAGGGCGCGATGCCGGGCGGCGCCGTGGTGGCCGTGAAGCGGCTGCCGGCCATCGGGCGCGCGGGCGCGGCGCACGACGACTACGGGTTCTCGGCGGAGATACAGACGCTGGGGCGCATCAGGCACCGCCACATCGTGCGGCTGCTCGGCTTCGCGGCCAACCGGGAGACCAACCTGCTGGTGTACGAGTACATGCCGAACGGCAGCCTCGGCGAGGTGCTCCACGGCAAGAAGGGCGGCCACCTGCAGTGGGCGACGCGGTTCAAGATCGCCGTGGAGGCGGCCAAGGGCCTCTGCTACCTGCACCACGACTGCTCGCCGCCGATCCTGCACCGCGACGTCAAGTCCAACAACATCCTCCTCGACGCCGACTTCGAGGCCCACGTCGCGGACTTCGGCCTCGCCAAGTTCCTCCGGGGCAACGCTGGCGGTTCGGAGTGCATGTCCGCTATCGCCGGCTCGTACGGCTACATTGCTCCTGAGTACGCCTACACGCTGAAGGTGGACGAGAAGAGCGACGTGTACAGCTTCGGCGTGGTGCTGCTGGAGCTCATCGCCGGGCGCAAGCCCGTCGGGGAGTTCGGCGACGGCGTGGACATCGTGCACTGGGTGCGGACGGTGACCGGGTCGAGCAAGGAGGGCGTGATGAAGATCGCCGACCCACGGCTCTCGACGGTGCCTCTGTACGAGCTAACCCACGTCTTCTACGTCGCCATGCTGTGCGTGGCGGAGCAGAGCGTGGAGCGGCCCACGATGCGCGAGGTCGTGCAGATACTGGCCGACATGCCCGGCTCGACATCCACGACGTCCATAGACGTGCCCCTTGTCATCGAGCCGAAGGAGGAGGACGGGGGCCCGGAGAAGAagcagcagcagcagcagGAAGGGCCACACGACTCGCCGCCGCAGCAGGATCTTCTTAGTATCTAGAAGCGCAGTTGCGAGAGTTGGTCGTACTGATGGTACTTGGTAGCATCCCTGCCTGCCCTGTTCTTTGAGTGAAGCGTTGGAACGTGGCGTGTGTGTAGTGTAACTGTGTATGCAGGCGGTGATTTATATGCATGCTTCCTTTAAGT


Protein sequences

Name Description Sequence
Zm.1140 translated coding region predicted by ESTScan from UniGene Zm.1140

AASTLLPVLLLIATATQCTAADSFSSQDAAALLNLSAAVADPSGYLSTHWTPDTAVCSWPRVSCDATDTRVISLDLSGLNLSGPIPAAALSSFPYLQSLNLSNNILNSTAFPDEIIASLKSLRVLDLYNNNLTGSLPAALPNLTDLVHVHLGGNFFSGSIPRSYGQWSRIRYLALSGNELTGEIPEELGNLTTLRELYLGYYNNFTGGIPPELGRLRALVRLDMANCGISEEIPPELANLTSLDTLFLQINALSGRLPTEIGAMGSLKSLDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFIGDLPNLEVLQLWENNFTGGIPTNLGVAATRLRIVDVSTNKLTGVLPSELCAGQRLETFIALGNSLFGDVPDGLAXVPVADEDSAGREFSQRDDTCKAVHVAEPDAGRAAQQFALRRAPAGRREGVFFDRRAESVQQPTDRPGAYRDRWTPGITEAVARREHVVRRAPAGGREASAALEGGPFWEPALRSGTPGDRQMPSAHLPRYLEQQGLRQHPAGARQPPHPQLPQRFPQRAPRGDSACHRRNAEPDSRGLLVQQPLGRGPVHRSVWLLQRHFLRRQRWPLRGVPLPVPLRGRGDFGPGLPLFDVQTPARARPPRAVRRLRGRGRAEGAVAEAVRRGARVAADGVPAAGLRRGRRAGLPQGGERDRQGRVRDRVQGRDAGRRRGGREAAAGHRARGRGARRLRVLGGDTDAGAHQAPPHRAAARLRGQPGDQPAGVRVHAERQPRRGAPRQEGRPPAVGDAVQDRRGGGQGPLLPAPRLLAADPHRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGSTSTTSIDVPLVIEPKEEDGGPEKKQQQQQEGPHDSPPQQDLLSI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
5-978 FAMILY NOT NAMED,FAMILY NOT NAMED

LLPVLLLIATATQCTAADSFSSQDAAALLNLSAAVADPSGYLSTHWTPDTAVCSWPRVSCDATDTRVISLDLSGLNLSGPIPAAALSSFPYLQSLNLSNNILNSTAFPDEIIASLKSLRVLDLYNNNLTGSLPAALPNLTDLVHVHLGGNFFSGSIPRSYGQWSRIRYLALSGNELTGEIPEELGNLTTLRELYLGYYNNFTGGIPPELGRLRALVRLDMANCGISEEIPPELANLTSLDTLFLQINALSGRLPTEIGAMGSLKSLDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFIGDLPNLEVLQLWENNFTGGIPTNLGVAATRLRIVDVSTNKLTGVLPSELCAGQRLETFIALGNSLFGDVPDGLAXVPVADEDSAGREFSQRDDTCKAVHVAEPDAGRAAQQFALRRAPAGRREGVFFDRRAESVQQPTDRPGAYRDRWTPGITEAVARREHVVRRAPAGGREASAALEGGPFWEPALRSGTPGDRQMPSAHLPRYLEQQGLRQHPAGARQPPHPQLPQRFPQRAPRGDSACHRRNAEPDSRGLLVQQPLGRGPVHRSVWLLQRHFLRRQRWPLRGVPLPVPLRGRGDFGPGLPLFDVQTPARARPPRAVRRLRGRGRAEGAVAEAVRRGARVAADGVPAAGLRRGRRAGLPQGGERDRQGRVRDRVQGRDAGRRRGGREAAAGHRARGRGARRLRVLGGDTDAGAHQAPPHRAAARLRGQPGDQPAGVRVHAERQPRRGAPRQEGRPPAVGDAVQDRRGGGQGPLLPAPRLLAADPHRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGSTSTTSIDVPLVIEPKEEDGGPEKKQQQQ

HMMPanther: PTHR24420:SF462
5-978 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LLPVLLLIATATQCTAADSFSSQDAAALLNLSAAVADPSGYLSTHWTPDTAVCSWPRVSCDATDTRVISLDLSGLNLSGPIPAAALSSFPYLQSLNLSNNILNSTAFPDEIIASLKSLRVLDLYNNNLTGSLPAALPNLTDLVHVHLGGNFFSGSIPRSYGQWSRIRYLALSGNELTGEIPEELGNLTTLRELYLGYYNNFTGGIPPELGRLRALVRLDMANCGISEEIPPELANLTSLDTLFLQINALSGRLPTEIGAMGSLKSLDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFIGDLPNLEVLQLWENNFTGGIPTNLGVAATRLRIVDVSTNKLTGVLPSELCAGQRLETFIALGNSLFGDVPDGLAXVPVADEDSAGREFSQRDDTCKAVHVAEPDAGRAAQQFALRRAPAGRREGVFFDRRAESVQQPTDRPGAYRDRWTPGITEAVARREHVVRRAPAGGREASAALEGGPFWEPALRSGTPGDRQMPSAHLPRYLEQQGLRQHPAGARQPPHPQLPQRFPQRAPRGDSACHRRNAEPDSRGLLVQQPLGRGPVHRSVWLLQRHFLRRQRWPLRGVPLPVPLRGRGDFGPGLPLFDVQTPARARPPRAVRRLRGRGRAEGAVAEAVRRGARVAADGVPAAGLRRGRRAGLPQGGERDRQGRVRDRVQGRDAGRRRGGREAAAGHRARGRGARRLRVLGGDTDAGAHQAPPHRAAARLRGQPGDQPAGVRVHAERQPRRGAPRQEGRPPAVGDAVQDRRGGGQGPLLPAPRLLAADPHRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGSTSTTSIDVPLVIEPKEEDGGPEKKQQQQ

Seg: seg
20-40 seg

AADSFSSQDAAALLNLSAAVA

HMMPfam: PF08263
IPR013210
26-65 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

SQDAAALLNLSAAVADPSGYLSTHWTPDTAVCSWPRVSCD

superfamily: SSF52058
34-379 L domain-like,LRR

NLSAAVADPSGYLSTHWTPDTAVCSWPRVSCDATDTRVISLDLSGLNLSGPIPAAALSSFPYLQSLNLSNNILNSTAFPDEIIASLKSLRVLDLYNNNLTGSLPAALPNLTDLVHVHLGGNFFSGSIPRSYGQWSRIRYLALSGNELTGEIPEELGNLTTLRELYLGYYNNFTGGIPPELGRLRALVRLDMANCGISEEIPPELANLTSLDTLFLQINALSGRLPTEIGAMGSLKSLDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFIGDLPNLEVLQLWENNFTGGIPTNLGVAATRLRIVDVSTNKLTGVLPSELCAGQRLETFIALGNSLFGDVP

Gene3D: G3DSA:3.80.10.10
50-206 no description

WTPDTAVCSWPRVSCDATDTRVISLDLSGLNLSGPIPAAALSSFPYLQSLNLSNNILNSTAFPDEIIASLKSLRVLDLYNNNLTGSLPAALPNLTDLVHVHLGGNFFSGSIPRSYGQWSRIRYLALSGNELTGEIPEELGNLTTLRELYLGYYNNFT

HMMPfam: PF13855
72-132 LRR_8,Leucine rich repeat

ISLDLSGLNLSGPIPAAALSSFPYLQSLNLSNNILNSTAFPDEIIASLKSLRVLDLYNNNL

Seg: seg
96-108 seg

LQSLNLSNNILNS

HMMSmart: SM00369
IPR003591
119-142 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLRVLDLYNNNLTGSLPAALPN

HMMPfam: PF00560
IPR001611
170-191 LRR_1
Leucine-rich repeat

IRYLALSGNELTGEIPEELGNL

Gene3D: G3DSA:3.80.10.10
207-379 no description

GGIPPELGRLRALVRLDMANCGISEEIPPELANLTSLDTLFLQINALSGRLPTEIGAMGSLKSLDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFIGDLPNLEVLQLWENNFTGGIPTNLGVAATRLRIVDVSTNKLTGVLPSELCAGQRLETFIALGNSLFGDVP

HMMSmart: SM00369
IPR003591
216-240 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRALVRLDMANCGISEEIPPELANL

HMMPfam: PF00560
IPR001611
219-240 LRR_1
Leucine-rich repeat

LVRLDMANCGISEEIPPELANL

HMMSmart: SM00369
IPR003591
264-287 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MGSLKSLDLSNNLFVGEIPASFAS

HMMPfam: PF13855
266-324 LRR_8,Leucine rich repeat

SLKSLDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFIGDLPNLEVLQLWENN

Seg: seg
288-301 seg

LKNLTLLNLFRNRL

HMMSmart: SM00369
IPR003591
288-312 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLTLLNLFRNRLAGEIPEFIGDL

Seg: seg
464-477 seg

AVARREHVVRRAPA

HMMSmart: SM00219
IPR020635
562-944 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LLVQQPLGRGPVHRSVWLLQRHFLRRQRWPLRGVPLPVPLRGRGDFGPGLPLFDVQTPARARPPRAVRRLRGRGRAEGAVAEAVRRGARVAADGVPAAGLRRGRRAGLPQGGERDRQGRVRDRVQGRDAGRRRGGREAAAGHRARGRGARRLRVLGGDTDAGAHQAPPHRAAARLRGQPGDQPAGVRVHAERQPRRGAPRQEGRPPAVGDAVQDRRGGGQGPLLPAPRLLAADPHRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQIL

Seg: seg
591-605 seg

PLRGVPLPVPLRGRG

ProfileScan: PS50011
IPR000719
596-950 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

PLPVPLRGRGDFGPGLPLFDVQTPARARPPRAVRRLRGRGRAEGAVAEAVRRGARVAADGVPAAGLRRGRRAGLPQGGERDRQGRVRDRVQGRDAGRRRGGREAAAGHRARGRGARRLRVLGGDTDAGAHQAPPHRAAARLRGQPGDQPAGVRVHAERQPRRGAPRQEGRPPAVGDAVQDRRGGGQGPLLPAPRLLAADPHRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGS

Seg: seg
619-669 seg

PARARPPRAVRRLRGRGRAEGAVAEAVRRGARVAADGVPAAGLRRGRRAGL

Seg: seg
671-718 seg

QGGERDRQGRVRDRVQGRDAGRRRGGREAAAGHRARGRGARRLRVLGG

HMMSmart: SM00220
IPR002290
693-943 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RRGGREAAAGHRARGRGARRLRVLGGDTDAGAHQAPPHRAAARLRGQPGDQPAGVRVHAERQPRRGAPRQEGRPPAVGDAVQDRRGGGQGPLLPAPRLLAADPHRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQI

Seg: seg
722-735 seg

AGAHQAPPHRAAAR

Seg: seg
774-795 seg

QDRRGGGQGPLLPAPRLLAADP

Gene3D: G3DSA:1.10.510.10
796-980 no description

HRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGSTSTTSIDVPLVIEPKEEDGGPEKKQQQQQE

HMMPfam: PF00069
IPR017442
796-940 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREV

superfamily: SSF56112
IPR011009
796-967 Protein kinase-like (PK-like)
Protein kinase-like domain

HRDVKSNNILLDADFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGSTSTTSIDVPLVIEPKEE

Seg: seg
963-982 seg

EPKEEDGGPEKKQQQQQEGP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox