PRGDB00063908 (Zm.2157)

From PRG Wiki
Jump to: navigation, search
Zm.2157
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195607479 (EU953452)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 1413397 mRNA sequence

DNA Sequence

GTGACACGGGAAAGGAGTACCGGAGACATCGTCAACGCCATGGCCGGAGGAGGTGCAACGGTGTGCGTGACCGGAGCCGGCGGGTTCATCGCCTCGTGGGTAGTGAAGCTCCTGCTCTCCCGCGGGTACACCGTGCACGGCACCGTCCGCCACCTCAGTGACGAGAAGACAGGCCACCTGAAGCGCCTGGAGAATGCTGCCGGAAACCTTAGGATCTTCAAGGCTGACCTGCTGGACTACGACGCCATGGCAGCTGCGGTCGTCGGGTGCCAGGGGGTTTTCCATGTGGCCACTCCTGTGCCTTCGGAGGACCTGACTGACCCAGAGCTACAAATGCTGGGTCCTGCTGTTACCGGCACCACGAATGTGCTCAAAGCTGCCTCCAGCGCGAACGTCCAGCGAGTGGTGGTGGTGTCGTCCATGGTTGCCGTCGAGATCAGCCCCAAAGATTGGCCTGAAGGTAAGGTCCGAGATGAGAGGTGCTGGTCAGACCGAGAGTTCTGCAGGAGCATTGAGAGCTGGTACCCGGTGGCTAAGATCATCTCAGAGGAGGCGGCGCTGGCGTACGGGCAGCAAACCGGGCTCGATGTGGTGACTATCAATCCAGGGTTGGTGTTCGGCCCCATGCTGCAGCCGACGGTCAACACGACCATCCAGTTCCTCATCTACTTCCTCAAAGGAGGCCCCGACCCGGTGAAGAACAAGCTCTGGCATATCGTCGACGTCCGTGATGTGGCCGACGCCATGCTGCTGCTCTACGAGGTGCCTGAAGCGACCGGCAGACACATCTGCGCGCCTCATGTTATCAGTGCCCGCGACCTGCTGGATCTGCTGAAGAGCATGTACCCTGACTACCCTTGCATTGCCAACGAGAGCATACTTGACAGAGACCACCCAGCGCCGATGACCTCTGACAAGCTGAAGAAGATCGGGTGGAGCTGCCGACCGCTGGAGGAGACGATCGTGGACACCGTCGAGTCTGAGCTCATCTccgcgcgctgccgccgccgccgccgccgctcgacgcccaccgcgcAGCCATGGCGGAACAGACCGAGAAGGCTTTTCTCAAGCAGCCTAAGGTGTTCCTCAGCTCAAAGAAATCTGGCAAGGGTAAGAAGCCAGGCAAGGGTGGCAATCGATTTTGGAAGAGCATTGSCCTTGGGGTTTCAAGACTCCCAGGGAAGCAATTGAAGGCACYTACATTGACAAGAAATGTCCATTCACTGGAACCGTTTCTATCAGAGGCAGAATTATTGCTGGAACATGCCACAGTGCTAAAATGAACAGAACCATCATTGTTCGCAGGAACTACCTCCACTTTGTTAAGAAATACCAGAGGTATGAAAAGAGGCACTCCAACATTCCAGCTCACATCTCCCCATGCTTCCGTGTGAAGGAAGGCGACCATGTCATCATTGGCCAGTGCAGGCCCCTATCAAAAACTGTGAGGTTCAATGTCGTTAAAGTCATTCCAGCTGGATCTGCTGCTGCTGGCAAGAAGGCTTTCACCGCAGCCTGAGTTTAAAACTATGTTCGATGAGTAGTTTATAGAGTGATGTCTTTTTTTGTTAAAAAAACTGCCTTCTAGGCTTGTGCCTTTCGAATATGGTTTGGAGATTGTTCCCATCTTAATGAAGTCCAATCATCTGAACATGTTACTGTTTATTGTACCTGTCGTGCAAAGTTTTGCAAGATCTGTATTGTTTCCGCaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.2157 translated coding region predicted by ESTScan from UniGene Zm.2157

VTRERSTGDIVNAMAGGGATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVESELISXALPPPPPPLDAHRAAMAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGXSILEEHXPWGFKTPREAIEGTYIDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLSKTVRFNVVKVIPAGSAAAGKKAFTAA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
4-354 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

ERSTGDIVNAMAGGGATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVESELISXALPPPPPPLDAHRAAMAEQTEK

HMMPanther: PTHR10366:SF74
4-354 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ERSTGDIVNAMAGGGATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVESELISXALPPPPPPLDAHRAAMAEQTEK

Seg: seg
15-28 seg

AGGGATVCVTGAGG

superfamily: SSF51735
18-329 NAD(P)-binding Rossmann-fold domains

GATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVESEL

Gene3D: G3DSA:3.40.50.720
IPR016040
19-282 no description
NAD(P)-binding domain

ATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMY

HMMPfam: PF01370
IPR001509
21-263 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHI

Seg: seg
75-86 seg

ADLLDYDAMAAA

Seg: seg
126-144 seg

AASSANVQRVVVVSSMVAV

Seg: seg
335-340 seg

PPPPPP

Seg: seg
365-381 seg

SSKKSGKGKKPGKGGXS

HMMTigr: TIGR03630
IPR019978
403-491 arch_S17P: archaeal ribosomal protein S17P
Ribosomal protein S17, archaeal

IDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLSKTVRFNVVKV

Gene3D: G3DSA:2.40.50.140
IPR012340
415-496 no description
Nucleic acid-binding, OB-fold

IRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLSKTVRFNVVKVIPAGS

superfamily: SSF50249
IPR016027
416-495 Nucleic acid-binding proteins
Nucleic acid-binding, OB-fold-like

RGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLSKTVRFNVVKVIPAG

BlastProDom: PD001295
IPR000266
418-488 Q7XIK5_ORYSA_Q7XIK5;
Ribosomal protein S17

RIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLSKTVRFNV

HMMPfam: PF00366
IPR000266
422-491 Ribosomal_S17
Ribosomal protein S17

GTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLSKTVRFNVVKV

FPrintScan: PR00973
IPR000266
436-459 RIBOSOMALS17
Ribosomal protein S17

RRNYLHFVKKYQRYEKRHSNIPAH

FPrintScan: PR00973
IPR000266
469-479 RIBOSOMALS17
Ribosomal protein S17

GDHVIIGQCRP

PatternScan: PS00056
IPR019979
469-481 RIBOSOMAL_S17
Ribosomal protein S17, conserved site

GDHVIIGQCRPLS

FPrintScan: PR00973
IPR000266
479-486 RIBOSOMALS17
Ribosomal protein S17

PLSKTVRF

Seg: seg
494-507 seg

AGSAAAGKKAFTAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox