PRGDB00063915 (Zm.2906)

From PRG Wiki
Jump to: navigation, search
Zm.2906
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21214215 (AY110115)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays CL444_1 mRNA sequence

DNA Sequence

CCACGCGTCCGAGAATTCGTCCCnnnnnnnnnnnnnnnnnnnnnnntccatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnGGAGGAGGAGTTCAGGAGGGAGAGGTCGGCGGCGGCGCGGCAGATCGGGTAGCACCGTGCAGCTCGGGCCTTAGGCGCACCAGCGGTNNNNNNATCCGCGCGCCCATGCGCCGGTGAGGTGGTGGGGCCCGCTTGGCGCTCGAGTTGGAAnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnGGTCGCGGTGCTGCTCGGGCCGGGACGGGTCGTCGCCAACACCGAGGGTGATGCCCTGTACAGCCTGCGTCAGAGCTTGAAAGATGCTAACAATGTCTTGCAGAGTTGGGATCCCACTCTTGTTAATCCATGTACATGGTTCCATGTTACGTGTAACAACGATAACAGTGTTATCAGAGTTGACCTTGGAAATGCACAATTATCTGGCGTTCTAGTGCCACAACTTGGCCAGCTGnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngcacgagctgannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnCCTGACAGCCTGGGGAATCTAGTGAAGCTGCGTTTCCTACGTCTTAACAACAATAGCTTGGTTGGTCCGATTCCCGTATCCTTGACCAATATCTCCACTCTCCAAGTACTGGATCTCTCGAACAACAACCTCTCAGGACAAGTCCCATCGACTnnnnnnnnnnnnnnnnnnnnnnnnnTAAGTTTTGCCAACAATCCAAATCTTTGTGGCCCTGGTACTTCGAAGCCCTGCCCTnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnTCCTCCATCTNNNNNAACTCAATCTACTGGTGCTTCTAGCACTGGAGCAATAGCTGGAGGTGTTGCTGCTGGTGCAGCATTGGTGTTTGCTGTTCCTGCAATTGCATTTGCAATGTGGCGCCGTCGTAAACCTGAAGAGCATTTCTTCGATGTTCCTGCCGAGGAGGATCCAGAAGTCCATCTTGGTCAGCTCNNNNNGTTTTCATTGCGGGAGCTTCAAGTTGCAACTGATAATTTCAGTAACAAGAACATTTTAGGAAGAGGCGGTTTTGGAAAAGTGTACAAAGGAAGGCTTGCTGATGGCTCATTGGTAGCAGTGAAAAGACTAAAAGAGGAGCGTACACCTGGTGGTGAGCTTCAGTTCCAAACAGAGGTTGAGATGATTAGCATGGCGGTGCACAAGAACCTTCTCCGACTTCGTGGTTTCTGCATGACACCTACTGAAAGGTTGTTAGTCTACCCATACATGGCTAACGGGAGTGTGGCATCACGTTTACGAGAGCGGCAGCCATCTGAGCCACCTCTTAGCTGGGAACCAAGAAGACGGATTGCACTGGGATCTGCAAGAGGACTTTCTTACTTGCATGATCACTGCGATCCCAAAATCATCCATCGGGATGTCAAAGCTGCAAATATTCTTTTGGATGAGGACTTCGAGGCAGTTGTGGGTGATTTCGGGCTTGCCAAGCTTATGGACTACAAGGATACCCATGTCACAACAGCTGTTCGTGGAACAATTGGGCACATTGCTCCCGAGTACCTATCTACCGGCAAGTCTTCTGAGAAGACTGATGNNNNNGGCTATGGGATCATGCTTCTGGAGCTTATTACTGGCCAGAGGGCATTTGATCTAGCTCGTCTTGCAAATGATGACGATGTTATGCTTCTTGACTGGGTGAAAGGACTGnnnnnnnnnnnnnnnnnnnnnnnnnTGGTGGACCCAGATCTGCAGAAAGCCTACGAGGAGGTCGAGGTGGAGAGCCTTATTCAGGTGGCACTCCTCTGCACGCAGGGCTCCCCGTTGGACCGTCCAAAGATGTCGGAGGTGGTGAGGATGCTCGAAGGTGACGGGCTGGCAGAGCGTTGGGACGAATGGCAGAAAGTAGAGGTGGTGAGGCAGGAGGCTGAGTCGGCACCGCTCCGCAATGACTGGATCGTCGATTCCACGTACAACCTTCGTGCCGTGGAGCTGTCCGGCCCAAGGTAGCCACTCCATGACTCCGATGAAAGAATTCAACACTGAATTGCCTAGATTCAGTCTAATTGCTGTGTGTATATGAAAGGTAGCTTTTGGAATTGTTAGCGACAATTTGAAAGGATCGnnnnnnnnnnnnnnnnnnnnnnGCTAGCTCAGATGTTGGTTACGCTGAGGTTGTGTTAAGGTGAAAATTCGTATATCTAAGGGTGAATTTCTAAAGCATTCTTGTAGTGGTTCGGGGAATGTAGCAGCGATCGTCCAATTGTACTACGTGCTATGAAGAACAGTGCTACCTTTTGGCCATAGTTTTGCGTTTTGNNNNNTCTATTTAGGTTTTCTTTGTGTNNNNNTACAATTGTCATTGAATT


Protein sequences

Name Description Sequence
Zm.2906 translated coding region predicted by ESTScan from UniGene Zm.2906

XHASENSSXXXXXXXXSXXXXXXXXXXXXGGGVQEGEVGGGAADRVAPCSSGLRRTSGXXIRXAHAPVRWWGPLGARVGXXXXXXXXXXXXXXXXVAVLLGPGRVVANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAQLSGVLVPQLGQLXXXXXXXXXXXXXXXXARAXXXXXXXXXXXXXXXXXXXXXXPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVPSTXXXXXXXXXSFANNPNLCGPGTSKPCPXXXXXXXXXXXXPPSXXTQSTGASSTGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLXXFSLRELQVATDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAESAPLRNDWIVDSTYNLRAVELPAQGSHSMTPMKEFNTELPRFSLIAVCI

Domains

Domain Start-End Description Sequence

Seg: seg
7-21 seg

SSXXXXXXXXSXXXX

Seg: seg
22-41 seg

XXXXXXXXGGGVQEGEVGGG

Seg: seg
79-95 seg

GXXXXXXXXXXXXXXXX

superfamily: SSF52058
104-173 L domain-like,LRR

RVVANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAQLSGVLVPQLGQL

HMMPanther: PTHR24420:SF351
104-727 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RVVANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAQLSGVLVPQLGQLXXXXXXXXXXXXXXXXARAXXXXXXXXXXXXXXXXXXXXXXPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVPSTXXXXXXXXXSFANNPNLCGPGTSKPCPXXXXXXXXXXXXPPSXXTQSTGASSTGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLXXFSLRELQVATDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAESAPLRNDWIVDSTYNLRAVELPAQGSHSMTPMKEFNTELPRFSLIAV

HMMPanther: PTHR24420
104-727 FAMILY NOT NAMED,FAMILY NOT NAMED

RVVANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAQLSGVLVPQLGQLXXXXXXXXXXXXXXXXARAXXXXXXXXXXXXXXXXXXXXXXPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVPSTXXXXXXXXXSFANNPNLCGPGTSKPCPXXXXXXXXXXXXPPSXXTQSTGASSTGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLXXFSLRELQVATDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAESAPLRNDWIVDSTYNLRAVELPAQGSHSMTPMKEFNTELPRFSLIAV

HMMPfam: PF08263
IPR013210
107-147 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCN

Coil: coil
173-174 coiled-coil

LX

Seg: seg
173-189 seg

LXXXXXXXXXXXXXXXX

Coil: coil
190-193 coiled-coil

ARAX

Seg: seg
192-211 seg

AXXXXXXXXXXXXXXXXXXX

Gene3D: G3DSA:3.80.10.10
212-265 no description

XXXPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVPST

superfamily: SSF52058
215-291 L domain-like,LRR

PDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVPSTXXXXXXXXXSFANNPNLCGPGTSKPC

HMMPfam: PF00560
IPR001611
248-264 LRR_1
Leucine-rich repeat

LQVLDLSNNNLSGQVPS

Seg: seg
265-274 seg

TXXXXXXXXX

Seg: seg
292-306 seg

PXXXXXXXXXXXXPP

Seg: seg
313-341 seg

TGASSTGAIAGGVAAGAALVFAVPAIAFA

Gene3D: G3DSA:2.60.120.200
IPR013320
315-401 no description
Concanavalin A-like lectin/glucanase, subgroup

ASSTGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLXXFSLRELQVATDNFSNKNILGRGGFGKVYKGR

superfamily: SSF56112
IPR011009
355-680 Protein kinase-like (PK-like)
Protein kinase-like domain

VPAEEDPEVHLGQLXXFSLRELQVATDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAE

ProfileScan: PS50011
IPR000719
383-670 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLEGDGLAERWDEWQ

HMMSmart: SM00219
IPR020635
383-657 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRML

HMMSmart: SM00220
IPR002290
383-657 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRML

HMMPfam: PF00069
IPR017442
385-599 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVML

PatternScan: PS00107
IPR017441
389-411 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLADGSLVAVK

Gene3D: G3DSA:3.30.200.20
402-460 no description

LADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFCMTPTERLLVYPYM

Gene3D: G3DSA:1.10.510.10
461-657 no description

ANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDXXGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLXXXXXXXXXVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRML

PatternScan: PS00108
IPR008271
506-518 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL

Seg: seg
606-615 seg

LXXXXXXXXX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox