PRGDB00063919 (Zm.3055)

From PRG Wiki
Jump to: navigation, search
Zm.3055
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195622447 (EU960936)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 229676 dihydroflavonol-4-reductase mRNA, complete cds

DNA Sequence

ACTGTGGAAGAACCGTTGAGCTGAGCCGAGCAGGGAGAAGGACGCGAGAGCAGCATGGAGACGGCGGAGAGGGGCACCACCGTGTGCGTGACCGGCGCGGGGGGCTTTGTGGCATCGTGGCTCGTCAAGCTCCTCCTCTCCACCGGCCGCTACACCGTCCGGGGTACCGTGCGTCATCTCGGTGATGGCAAGAATGCCCATCTTAAGACACTGGAAGATGCCGGGGAGAGGCTGCAGTTGGTCAAGGCTGACATGCTGGACTATGGCAGCGTTGCGTCCGCGGTCGCCGGCTGTCAGGGTGTCTTCCATGTCGCGAGCCCTGTCCCCTCCGGCAAATCCTCCAACCCTGAGGAAGATGTCATTGCTCCTGCTGTAACTGGCACACTGAATGTGTTGAAAGCTTGCTATGAGGCCAAAGCGAAGAGAGTTGTTGTGGTATCTTCAGTGGCTGCTGTGTTCAATAATCCTGACTGGCCTAAGGGCGAGGCCTTTACTGAGGATAGCTGGTCAGATGGGGAATATTGCAGAAAAAATGAGGAATGGTATTTCCTTTCTAAAACATTGGCAGAACATGAGGCTTTTGCTTATGCAGCCAAAACTGGGCTAGACATTGTAACTATTTGCCCATCATTGGTAATTGGACCTTTGTTGCAACCTGCAGTAAATACAAGTATTAAAGTCTTCCTCAGTTATATCAAAGGAGATCAGGAGATAGTTAAAGATGGACCCAAAAATCTTGTGGATGTTCGTGATGTCGCTGGTGCCCTTCTGTTGGCTTACGAAAATCTGCAGGCATCTGGACGATACCTCTGCAGCTCACCAGCAATAAGAGTCTCTGATATTGTAAACATACTGAAGACCGAATATCCAACATACACTTACCCTCAAAAATTCGTTGAAGCAGAAGGTAGCAACACATACAACACGGAGAAGCTTCGGAAGCTAGGGTGGACCTCTAGGCCCATGGAGGAAACCCTCCGGGACAGCATCGAATGCTACAGAGCTTTGGGCATCCTGAACTGAGcttcccttcagctttgggctttggctgctgctgctgctgctacttttcagcttctttcttcttCATGTAAACAGTGAATCAGAAATTCAGAATACGCTGGTATAGGAACTAGAGAAGTGGATCATGGAAGATGCTGATGCTAAAAATGAATTTGGATACTATCCATCATTTGTGCCTGCGGGATTGAGGGCAAATTAATTAAGTACTTATATTTGTAAATCTGGGGCCGTCGAACTGAACCAACAATGAAGAGGTGAAGAACAAATCGAAGTGGTAGATGAGTGCATTGCTGTGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.3055 translated coding region predicted by ESTScan from UniGene Zm.3055

TVEEPLSXAEQGEGRESSMETAERGTTVCVTGAGGFVASWLVKLLLSTGRYTVRGTVRHLGDGKNAHLKTLEDAGERLQLVKADMLDYGSVASAVAGCQGVFHVASPVPSGKSSNPEEDVIAPAVTGTLNVLKACYEAKAKRVVVVSSVAAVFNNPDWPKGEAFTEDSWSDGEYCRKNEEWYFLSKTLAEHEAFAYAAKTGLDIVTICPSLVIGPLLQPAVNTSIKVFLSYIKGDQEIVKDGPKNLVDVRDVAGALLLAYENLQASGRYLCSSPAIRVSDIVNILKTEYPTYTYPQKFVEAEGSNTYNTEKLRKLGWTSRPMEETLRDSIECYRALGILNXASLQLWALAAAAAATFQLLSSSCKQXIRNSEYAGMELEKWIMEDADAKNEFGYYPSFVPAGLRAN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF74
10-359 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EQGEGRESSMETAERGTTVCVTGAGGFVASWLVKLLLSTGRYTVRGTVRHLGDGKNAHLKTLEDAGERLQLVKADMLDYGSVASAVAGCQGVFHVASPVPSGKSSNPEEDVIAPAVTGTLNVLKACYEAKAKRVVVVSSVAAVFNNPDWPKGEAFTEDSWSDGEYCRKNEEWYFLSKTLAEHEAFAYAAKTGLDIVTICPSLVIGPLLQPAVNTSIKVFLSYIKGDQEIVKDGPKNLVDVRDVAGALLLAYENLQASGRYLCSSPAIRVSDIVNILKTEYPTYTYPQKFVEAEGSNTYNTEKLRKLGWTSRPMEETLRDSIECYRALGILNXASLQLWALAAAAAATFQL

HMMPanther: PTHR10366
10-359 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

EQGEGRESSMETAERGTTVCVTGAGGFVASWLVKLLLSTGRYTVRGTVRHLGDGKNAHLKTLEDAGERLQLVKADMLDYGSVASAVAGCQGVFHVASPVPSGKSSNPEEDVIAPAVTGTLNVLKACYEAKAKRVVVVSSVAAVFNNPDWPKGEAFTEDSWSDGEYCRKNEEWYFLSKTLAEHEAFAYAAKTGLDIVTICPSLVIGPLLQPAVNTSIKVFLSYIKGDQEIVKDGPKNLVDVRDVAGALLLAYENLQASGRYLCSSPAIRVSDIVNILKTEYPTYTYPQKFVEAEGSNTYNTEKLRKLGWTSRPMEETLRDSIECYRALGILNXASLQLWALAAAAAATFQL

superfamily: SSF51735
15-335 NAD(P)-binding Rossmann-fold domains

RESSMETAERGTTVCVTGAGGFVASWLVKLLLSTGRYTVRGTVRHLGDGKNAHLKTLEDAGERLQLVKADMLDYGSVASAVAGCQGVFHVASPVPSGKSSNPEEDVIAPAVTGTLNVLKACYEAKAKRVVVVSSVAAVFNNPDWPKGEAFTEDSWSDGEYCRKNEEWYFLSKTLAEHEAFAYAAKTGLDIVTICPSLVIGPLLQPAVNTSIKVFLSYIKGDQEIVKDGPKNLVDVRDVAGALLLAYENLQASGRYLCSSPAIRVSDIVNILKTEYPTYTYPQKFVEAEGSNTYNTEKLRKLGWTSRPMEETLRDSIECYRA

Gene3D: G3DSA:3.40.50.720
IPR016040
27-239 no description
NAD(P)-binding domain

TVCVTGAGGFVASWLVKLLLSTGRYTVRGTVRHLGDGKNAHLKTLEDAGERLQLVKADMLDYGSVASAVAGCQGVFHVASPVPSGKSSNPEEDVIAPAVTGTLNVLKACYEAKAKRVVVVSSVAAVFNNPDWPKGEAFTEDSWSDGEYCRKNEEWYFLSKTLAEHEAFAYAAKTGLDIVTICPSLVIGPLLQPAVNTSIKVFLSYIKGDQEIV

HMMPfam: PF01370
IPR001509
28-269 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFVASWLVKLLLSTGRYTVRGTVRHLGDGKNAHLKTLEDAGERLQLVKADMLDYGSVASAVAGCQGVFHVASPVPSGKSSNPEEDVIAPAVTGTLNVLKACYEAKAKRVVVVSSVAAVFNNPDWPKGEAFTEDSWSDGEYCRKNEEWYFLSKTLAEHEAFAYAAKTGLDIVTICPSLVIGPLLQPAVNTSIKVFLSYIKGDQEIVKDGPKNLVDVRDVAGALLLAYENLQASGRY

Seg: seg
143-152 seg

VVVVSSVAAV

Seg: seg
339-363 seg

LNXASLQLWALAAAAAATFQLLSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox