PRGDB00063931 (Zm.4950)

From PRG Wiki
Jump to: navigation, search
Zm.4950
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195648063 (EU971382)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 363399 serine

DNA Sequence

ACTCGCGGTACCAGCGCGGTGGAGGAGGCACTGGCGGCCCATCGTCCGCGCCGAGCGATGGCGTCCCCGCTCCTGTGCGTCCTCCTCTACCTACTCCGCCACCTTACGGCCTGCCACGCCGCCAGGGACACCATCACGCCGGACCGGCCGCTGGCGGGCAACGAGACGCTGGTCTCGGGCGGCGAGGGCAACTTCGCGCTCGGCTTCTTCACCCCGCCGGGCGCCAACAGCACCTACCTCGGCGTGTGGTACAACAAGGTCTCCCTCCGCACCGTGGTGTGGGTGGCCAACCGCGAGGCCCCGATCGCGGGCGCCGTCGGGGACAACCCCGGCGCCACGCTCTCCGTGTCCGCCGGCGGCACGCTCGCCATTGCCGCGGGGAACAGGACCGTCGTGTGGTCCGTCGAGCCGGCGTCCAGGCTGGCGAGCCCGGCCGCCCAGATCCTGGACAACGGCAACCTGGTGCTCAAGGACGGTGCCGGCGGCGGCGCCGTGGCGTGGGAGGGGTTCGACTACCCGACGGACACGATGCTCCCGGAGATGAAGCTGGGGATCGACTACGTGAAAGGGAAGAACAGGACGCTGACGTCGTGGAAAAGCCCGTCGGACCCCTCCCCGGGCCCCGTGGCCATGGTGATGGACACCAGCGGCGACCCGCAGGTGTTCATCTGGAACGGCGGCGAGAAGGTCTGGCGGTCCGGGCCCTGGGACGGCGTCCAGTTCACCGGCGTGCCGGACACGGCCACCTACTCCGGCTTCACCTTCAGCTTCGTAAACAGCGCGCGGGAGGTGACGTACAGCTTCCAGGTGCACAACGTGTCCATCATCTCGCACCTGGGCGTCGTGAGCACGGGGAACTACGGGCTGCTGCAGCGCTCGACGTGGGTGGAGGCGGCGCGGGCGTGGAACCTGTACTGGTACGCCCCCAAGGACCAGTGCGACGCGGTGTCGCCGTGCGGGCCCAACGGCGTGTGCGACACCAACAACATGCCGGTCTGCTCCTGCCTCCGCGGCTTCACCCCGAGGACCCCCGCCGCGTGGGCGCTGCGGGACGGCCGCGACGGGTGCGTGCGGTCCACGCCGCTGGACTGCCGCAACGGCACCGACGGCTTCGTCACGGTGCGCCACGCCAAGGTGCCCGACACGGAGCGGAGCGCGGTGGACTGGAGCCTGACGCTGGACCAGTGCCGCCAGGCGTGCCTCCGCAACTGCTCCTGcaccgcgtacgccagcgccaacgtcagcggcggcgccggcggtgggcgccgcgccggcgccggCTCGGGCTGCGTCATGTGGACCACGGGGCTCACCGACCTGCGCGTGTACCCCGACTTCGGCCAGGACCTCTTCGTCCGCCTCGCCGCCGCGGATCTCGATGTAGAAGCTAAATCAAGGGAGGCGCGCATCAAAATCGCAGTCGGCGCCAGCGTCTCGGCGCTGGCGCTTCTTCTAGCAGTCGCTGGTCTCCTCATCTGGTCATGGAGGAGAAGACTAACAAGAACAGACGGATCAAGTAAATGGAGTAGCTCCCGCCCCACCGGCCGCCGGTACGAGGGAAGCAGCCACGGTGACGACCTGGAGCTGCCAATATTTGATGTGGGGACGATTGCAGCTGCCACGGATGGTTACTCGATCGAAAACAAGCTTGGCGAGGGTGGATTTGGACCAGTGTACAAGGGTAAGCTCGAGGACGGAATGGAAATCGCAGTGAAGACACTCTCGAAGACGTCTGCACAAGGGCTAGACGAGTTCAAGAACGAGGTCTTGTTGATAGCCAAGCTCCAGCATCGCAATCTTGTCCGGCTTCTTGGGTGCAGCGTCAGTGGGCAAGAAAGGATGCTTGTTTACGAGTACATGGCAAACAAGAGCCTGGACTATTTCCTGTTTGAGAAGGACAACGTTGTGCTCGATTGGCAAGTGCGGTACCGTATAATAGAAGGCATTACTCGAGGTCTACTCTACCTCCACCAGGACTCGAGATACAGGATCATCCACAGAGATCTGAAGGCAGCTAATGTCCTTCTGGACAAGGAGATGACGCCCAAAATCTCAGACTTTGGCATGGCGAGGATATTTGGCAACGAAGAGACAGAAATCAATACCCGAAAAGTGGTCGGCACATACGGTTATATGTCTCCGGAGTATGCAATGGATGGGATCTTCTCTGTCAAGTCGGACGTATTCAGCTATGGAGTATTGCTGCTGGAAATCGTCAGCGGTAGGAGGAACAGAGGAGTGTATTCCTATTCAAACAACCAAAGCCTTCTAGGCCATGCATGGAGCTTGTGGAACGAGGAGAAGAGCATAGAGCTAGCAGACGAAAGAATGAATGGGTCGTTCAACTCGGACGAAGTGCAGAAGTGCATCAGAGTTGGGCTCTTGTGCGTGCAGGAGAACCCAGACGACCGTCCGCTGATGTCTCAGGTGCTTCTGATGCTGGCTAGTACCGATGCCACCTCACTGCCAACTCCTAAGCAACCTGGCTTCGCCGCTAGGAGAGTTCTGATGGAAACAGACACGTCGTCAACCAAGCCAGACTGCAGCATATTTGACAGTGCAACAATTACCATGCTTGAAGGTCGATAGTAGTAGTTATGAGTTATGACTGAAATGAAACTTAAACTGCTAGGGAAATGTGTATTGTAGAGTAAATTTGGCGGCCTCTTCAGTATCTTGTGTGCTTAAGCAGCAGAAAATTATATGAATATTGAATAATAGCAGGCAGCAGCTGGTAGAAACTTTGTTGCTTTTaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.4950 translated coding region predicted by ESTScan from UniGene Zm.4950

XSRYQRGGGGTGGPSSAPSDGVPAPVRPPLPTPPPYGLPRRQGHHHAGPAAGGQRDAGLGGEGNFALGFFTPPGANSTYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNRTVVWSVEPASRLASPAAQILDNGNLVLKDGAGGGAVAWEGFDYPTDTMLPEMKLGIDYVKGKNRTLTSWKSPSDPSPGPVAMVMDTSGDPQVFIWNGGEKVWRSGPWDGVQFTGVPDTATYSGFTFSFVNSAREVTYSFQVHNVSIISHLGVVSTGNYGLLQRSTWVEAARAWNLYWYAPKDQCDAVSPCGPNGVCDTNNMPVCSCLRGFTPRTPAAWALRDGRDGCVRSTPLDCRNGTDGFVTVRHAKVPDTERSAVDWSLTLDQCRQACLRNCSCTAYASANVSGGAGGGRRAGAGSGCVMWTTGLTDLRVYPDFGQDLFVRLAAADLDVEAKSREARIKIAVGASVSALALLLAVAGLLIWSWRRRLTRTDGSSKWSSSRPTGRRYEGSSHGDDLELPIFDVGTIAAATDGYSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLMLASTDATSLPTPKQPGFAARRVLMETDTSSTKPDCSIFDSATITMLEGR

Domains

Domain Start-End Description Sequence

Seg: seg
7-13 seg

GGGGTGG

Seg: seg
21-40 seg

GVPAPVRPPLPTPPPYGLPR

Seg: seg
43-53 seg

GHHHAGPAAGG

ProfileScan: PS50927
IPR001480
44-169 BULB_LECTIN
Bulb-type lectin domain

HHHAGPAAGGQRDAGLGGEGNFALGFFTPPGANSTYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNRTVVWSVEPASRLASPAAQILDNGNLVLKDGAGGGAVAWEG

HMMSmart: SM00108
IPR001480
47-173 Bulb-type mannose-specific lectin
Bulb-type lectin domain

AGPAAGGQRDAGLGGEGNFALGFFTPPGANSTYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNRTVVWSVEPASRLASPAAQILDNGNLVLKDGAGGGAVAWEGFDYP

HMMPanther: PTHR24420:SF763
64-860 OS01G0784700 PROTEIN

NFALGFFTPPGANSTYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNRTVVWSVEPASRLASPAAQILDNGNLVLKDGAGGGAVAWEGFDYPTDTMLPEMKLGIDYVKGKNRTLTSWKSPSDPSPGPVAMVMDTSGDPQVFIWNGGEKVWRSGPWDGVQFTGVPDTATYSGFTFSFVNSAREVTYSFQVHNVSIISHLGVVSTGNYGLLQRSTWVEAARAWNLYWYAPKDQCDAVSPCGPNGVCDTNNMPVCSCLRGFTPRTPAAWALRDGRDGCVRSTPLDCRNGTDGFVTVRHAKVPDTERSAVDWSLTLDQCRQACLRNCSCTAYASANVSGGAGGGRRAGAGSGCVMWTTGLTDLRVYPDFGQDLFVRLAAADLDVEAKSREARIKIAVGASVSALALLLAVAGLLIWSWRRRLTRTDGSSKWSSSRPTGRRYEGSSHGDDLELPIFDVGTIAAATDGYSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLMLASTDATSLPTPKQPGFAARRVLMETDTSSTKPDCSIFDSATITMLE

HMMPanther: PTHR24420
64-860 FAMILY NOT NAMED,FAMILY NOT NAMED

NFALGFFTPPGANSTYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNRTVVWSVEPASRLASPAAQILDNGNLVLKDGAGGGAVAWEGFDYPTDTMLPEMKLGIDYVKGKNRTLTSWKSPSDPSPGPVAMVMDTSGDPQVFIWNGGEKVWRSGPWDGVQFTGVPDTATYSGFTFSFVNSAREVTYSFQVHNVSIISHLGVVSTGNYGLLQRSTWVEAARAWNLYWYAPKDQCDAVSPCGPNGVCDTNNMPVCSCLRGFTPRTPAAWALRDGRDGCVRSTPLDCRNGTDGFVTVRHAKVPDTERSAVDWSLTLDQCRQACLRNCSCTAYASANVSGGAGGGRRAGAGSGCVMWTTGLTDLRVYPDFGQDLFVRLAAADLDVEAKSREARIKIAVGASVSALALLLAVAGLLIWSWRRRLTRTDGSSKWSSSRPTGRRYEGSSHGDDLELPIFDVGTIAAATDGYSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLMLASTDATSLPTPKQPGFAARRVLMETDTSSTKPDCSIFDSATITMLE

superfamily: SSF51110
IPR001480
80-239 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LGVWYNKVSLRTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNRTVVWSVEPASRLASPAAQILDNGNLVLKDGAGGGAVAWEGFDYPTDTMLPEMKLGIDYVKGKNRTLTSWKSPSDPSPGPVAMVMDTSGDPQVFIWNGGEKVWRSGPWDGV

HMMPfam: PF01453
IPR001480
90-205 B_lectin
Bulb-type lectin domain

RTVVWVANREAPIAGAVGDNPGATLSVSAGGTLAIAAGNRTVVWSVEPASRLASPAAQILDNGNLVLKDGAGGGAVAWEGFDYPTDTMLPEMKLGIDYVKGKNRTLTSWKSPSDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
206-243 no description
Bulb-type lectin domain

PGPVAMVMDTSGDPQVFIWNGGEKVWRSGPWDGVQFTG

HMMPfam: PF00954
IPR000858
231-342 S_locus_glycop
S-locus glycoprotein

WRSGPWDGVQFTGVPDTATYSGFTFSFVNSAREVTYSFQVHNVSIISHLGVVSTGNYGLLQRSTWVEAARAWNLYWYAPKDQCDAVSPCGPNGVCDTNNMPVCSCLRGFTPR

ProfileScan: PS50026
IPR000742
309-345 EGF_3
Epidermal growth factor-like, type 3

PKDQCDAVSPCGPNGVCDTNNMPVCSCLRGFTPRTPA

HMMPfam: PF08276
IPR013227
364-440 PAN_2
PAN-2 domain

CRNGTDGFVTVRHAKVPDTERSAVDWSLTLDQCRQACLRNCSCTAYASANVSGGAGGGRRAGAGSGCVMWTTGLTDL

ProfileScan: PS50948
IPR003609
364-455 PAN
Apple-like

CRNGTDGFVTVRHAKVPDTERSAVDWSLTLDQCRQACLRNCSCTAYASANVSGGAGGGRRAGAGSGCVMWTTGLTDLRVYPDFGQDLFVRLA

HMMSmart: SM00473
IPR003609
366-454 divergent subfamily of APPLE domains
Apple-like

NGTDGFVTVRHAKVPDTERSAVDWSLTLDQCRQACLRNCSCTAYASANVSGGAGGGRRAGAGSGCVMWTTGLTDLRVYPDFGQDLFVRL

Seg: seg
415-429 seg

SGGAGGGRRAGAGSG

Seg: seg
473-491 seg

AVGASVSALALLLAVAGLL

superfamily: SSF56112
IPR011009
530-845 Protein kinase-like (PK-like)
Protein kinase-like domain

PIFDVGTIAAATDGYSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLMLASTDATSLPTPKQPGFAARRVLMETDTSSTK

Gene3D: G3DSA:3.30.200.20
530-606 no description

PIFDVGTIAAATDGYSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGC

ProfileScan: PS50011
IPR000719
544-830 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLMLASTDATSLPTPKQPGF

HMMSmart: SM00219
IPR020635
544-814 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLML

HMMSmart: SM00220
IPR002290
544-816 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YSIENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLMLAS

HMMPfam: PF07714
IPR001245
546-812 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

IENKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLDEFKNEVLLIAKLQHRNLVRLLGCSVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLL

Gene3D: G3DSA:1.10.510.10
607-818 no description

SVSGQERMLVYEYMANKSLDYFLFEKDNVVLDWQVRYRIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVQKCIRVGLLCVQENPDDRPLMSQVLLMLASTD

PatternScan: PS00108
IPR008271
664-676 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKAANVLL

HMMPfam: PF11883
IPR021820
817-862 DUF3403
S-locus receptor kinase, C-terminal

TDATSLPTPKQPGFAARRVLMETDTSSTKPDCSIFDSATITMLEGR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox