PRGDB00063935 (Zm.5446)

From PRG Wiki
Jump to: navigation, search
Zm.5446
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614579 (EU957002)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1580113 BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, mRNA, complete cds

DNA Sequence

AACCCGCGCACACCACCACCAGTCAGTCCAGTTCCCGCAGTGCACTGCTCTACGCCACAGTACAGCAGCGGCCAGCGGCTGCCTAATCTCTCCAGCCCTTTTTCGTCCCCTAGCCACGCCGCCCACCGCTGCCGCGTCATCCGCCCGTCGTCGCCTGCCCCGCGGCTTCTGCCCCCATTCGCCGCCGAAGCACGCCGAGCCCCGTCCCAGATCGCCGCGGCGCAGGGTTGGAAATCTGTTTGACCACTCAGTGAGTGGCTTCATGTTAAATCCATTTCTGGTTTCAAGATGCTTCACCAATGACATCTGGAAACTGTAATAGTATGTCCTGATCTTCTATGCTTCACCACCTGATCATCAATGGGCTCTTTCCTGAGGAAACAGCCCAGCTACCTCTTCATTTTGATAATTCTGCACCTTGTTGCTCACGAGGCAAGAACACTGAGTTCAGATGGCGAAGCACTTCTTGCCTTCAAAAAAGCAGTTACAAATTCAGATGGAGTCTTCCTAAATTGGCGTGAGCAAGATGCAGACCCCTGCAATTGGAAGGGTGTTAGATGTGATAGTCATAGCAAGAGAGTGATTAATCTGATTCTTGCATACCACAGATTAGTTGGGCCCATACCACCAGAAATTGGAAGGTTAAATCAGTTGCAAACCTTGTCATTGCAGGGGAACAGTTTGTATGGTTCACTCCCTCCTGAACTGGGGAATTGTACCAAGTTGCAACAACTGTATCTACAAGGAAATTACTTAAGTGGATACATCCCTTCAGAATTCGGCGAGCTGGTGGAACTCGAGGCATTGGACTTATCCAGTAATACATTGAGTGGATCTGTTCCACATTCTCTTGATAAGTTGTCCAAACTTACATCATTCAATGTTTCCATGAACTTCCTGACAGGAGCAATACCATCTTCTGGTTCACTTGACAATTTCAATGAGACATCCTTTGTTGGGAACCTTGGTTTATGTGGGAAGCAGATAAACTCGGTGTGCAAAGATGCCCTTCAATCACCATCAAATGGTCTGCAGTCACCTTCCCCAGACGACATGATTAACAAAAGGAACGGGAAGAATTCTACCAGACTTGTTATAAGTGCAGTGGCAACAGTGGGAGCTCTCCTATTGGTGGCTTTAATGTGTTTCTGGGGTTGCTTTCTTTACAAAAATTTTGGAAAGAAAGATATGCGTGGTTTCAGAGTTGAGCTCTGTGGAGGCTCTTCTGTTGTGATGTTCCATGGAGACCTCCCTTACTCCTCAAAAGACATACTCAAGAAGCTAGAGACTATGGATGAAGAAAATATCATTGGAGCAGGAGGCTTCGGAACTGTTTATAAACTTGCAATGGATGATGGCAATGTCTTTGCTTTGAAAAGAATAGTGAAAACAAATGAAGGGCTAGATCGGTTCTTTGATAGAGAACTTGAGATATTGGGAAGTGTTAAACATCGCTATTTGGTCAATCTTCGTGGTTATTGCAACTCTCCTTCATCAAAACTTTTGATATATGATTATCTTCAAGGTGGAAGCCTGGATGAAGTGCTTCATGAAAAGTCTGAACAGTTGGATTGGGATGCACGTATTAACATCATACTTGGAGCTGCAAAAGGCTTGTCTTACTTGCATCACGATTGTTCGCCTCGAATAATACATCGTGATATCAAGTCGAGCAACATCTTGCTTGACGGCAGTTTTGAGGCCCGCGTATCAGACTTTGGACTTGCGAAGCTTTTAGAGGACGAAGAATCACATATCACTACAATAGTTGCAGGAACATTTGGTTATCTTGCGCCAGAGTATATGCAGTTTGGCAGAGCCACCGAGAAGACCGATGTCTACAGTTTTGGGGTTCTGGTACTTGAAATACTCAGCGGAAAGCGGCCTACCGATGCATCCTTCATTGAGAAGGGATTAAACATTGTTGGATGGTTAAATTTTCTGGCTGGCGAGAACCGGGAGAGGGAAATCGTCGATCTGAATTGTGAAGGAGTGCACACCGAGACCTTGGACGCTCTGCTCTCTCTCGCCAAGCAGTGCGTCAGCTCTTTGCCGGAGGAGCGGCCGACGATGCACAGGGTGGTACAGATGCTGGAGTCGGATGTAATTACGCCGTGCCCTAGCGACTTCTACGATTCAGAGTAGCCTCCTGGACGGACAAGCCACAGTGGTGCCGCTAGTTTCCCGTGGAGGCGCATTCCTTTATTCTTTGCAGATATTGTGTAAATGCATTGCCGCGGTGTTTGTTTGGTCTCCTCCAATCGGCTGGTTCAACGGGTGACATTTTTGCGTCTGTGTTTATCTGTCATGCTACAAGTTGGCTATATGCTAATTTAATAAGAGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.5446 translated coding region predicted by ESTScan from UniGene Zm.5446

NPRTPPPVSPVPAVHCSTPQYSSGQRLPNLSSPFSSPSHAAHRCRVIRPSSPAPRLLPPFAAEARRAPSQIAAAQGWKSVXPLSEWLHVKSISGFKMLHQXHLETVIVCPDLLCFTTXSSMGSFLRKQPSYLFILIILHLVAHEARTLSSDGEALLAFKKAVTNSDGVFLNWREQDADPCNWKGVRCDSHSKRVINLILAYHRLVGPIPPEIGRLNQLQTLSLQGNSLYGSLPPELGNCTKLQQLYLQGNYLSGYIPSEFGELVELEALDLSSNTLSGSVPHSLDKLSKLTSFNVSMNFLTGAIPSSGSLDNFNETSFVGNLGLCGKQINSVCKDALQSPSNGLQSPSPDDMINKRNGKNSTRLVISAVATVGALLLVALMCFWGCFLYKNFGKKDMRGFRVELCGGSSVVMFHGDLPYSSKDILKKLETMDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVITPCPSDFYDSEXPPGRTSHSGAASFPWRRIPLFFADIV

Domains

Domain Start-End Description Sequence

Seg: seg
2-14 seg

PRTPPPVSPVPAV

Seg: seg
31-42 seg

SSPFSSPSHAAH

Seg: seg
48-69 seg

RPSSPAPRLLPPFAAEARRAPS

HMMPanther: PTHR24420:SF479
112-712 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LLCFTTXSSMGSFLRKQPSYLFILIILHLVAHEARTLSSDGEALLAFKKAVTNSDGVFLNWREQDADPCNWKGVRCDSHSKRVINLILAYHRLVGPIPPEIGRLNQLQTLSLQGNSLYGSLPPELGNCTKLQQLYLQGNYLSGYIPSEFGELVELEALDLSSNTLSGSVPHSLDKLSKLTSFNVSMNFLTGAIPSSGSLDNFNETSFVGNLGLCGKQINSVCKDALQSPSNGLQSPSPDDMINKRNGKNSTRLVISAVATVGALLLVALMCFWGCFLYKNFGKKDMRGFRVELCGGSSVVMFHGDLPYSSKDILKKLETMDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVITPCPSDFYD

HMMPanther: PTHR24420
112-712 FAMILY NOT NAMED,FAMILY NOT NAMED

LLCFTTXSSMGSFLRKQPSYLFILIILHLVAHEARTLSSDGEALLAFKKAVTNSDGVFLNWREQDADPCNWKGVRCDSHSKRVINLILAYHRLVGPIPPEIGRLNQLQTLSLQGNSLYGSLPPELGNCTKLQQLYLQGNYLSGYIPSEFGELVELEALDLSSNTLSGSVPHSLDKLSKLTSFNVSMNFLTGAIPSSGSLDNFNETSFVGNLGLCGKQINSVCKDALQSPSNGLQSPSPDDMINKRNGKNSTRLVISAVATVGALLLVALMCFWGCFLYKNFGKKDMRGFRVELCGGSSVVMFHGDLPYSSKDILKKLETMDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVITPCPSDFYD

superfamily: SSF52058
145-333 L domain-like,LRR

ARTLSSDGEALLAFKKAVTNSDGVFLNWREQDADPCNWKGVRCDSHSKRVINLILAYHRLVGPIPPEIGRLNQLQTLSLQGNSLYGSLPPELGNCTKLQQLYLQGNYLSGYIPSEFGELVELEALDLSSNTLSGSVPHSLDKLSKLTSFNVSMNFLTGAIPSSGSLDNFNETSFVGNLGLCGKQINSVC

Gene3D: G3DSA:3.80.10.10
148-309 no description

LSSDGEALLAFKKAVTNSDGVFLNWREQDADPCNWKGVRCDSHSKRVINLILAYHRLVGPIPPEIGRLNQLQTLSLQGNSLYGSLPPELGNCTKLQQLYLQGNYLSGYIPSEFGELVELEALDLSSNTLSGSVPHSLDKLSKLTSFNVSMNFLTGAIPSSGS

HMMPfam: PF08263
IPR013210
149-188 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

SSDGEALLAFKKAVTNSDGVFLNWREQDADPCNWKGVRCD

HMMPfam: PF12799
217-253 LRR_4,Leucine Rich repeats (2 copies)

QLQTLSLQGNSLYGSLPPELGNCTKLQQLYLQGNYLS

HMMPfam: PF00560
IPR001611
266-287 LRR_1
Leucine-rich repeat

LEALDLSSNTLSGSVPHSLDKL

Seg: seg
368-380 seg

AVATVGALLLVAL

superfamily: SSF56112
IPR011009
403-721 Protein kinase-like (PK-like)
Protein kinase-like domain

ELCGGSSVVMFHGDLPYSSKDILKKLETMDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVITPCPSDFYDSEXPPGRTS

Gene3D: G3DSA:3.30.200.20
422-506 no description

KDILKKLETMDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDY

ProfileScan: PS50011
IPR000719
431-703 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVI

HMMSmart: SM00220
IPR002290
431-703 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVI

HMMSmart: SM00219
IPR020635
431-698 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MDEENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQML

HMMPfam: PF00069
IPR017442
434-696 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGLDRFFDRELEILGSVKHRYLVNLRGYCNSPSSKLLIYDYLQGGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQ

PatternScan: PS00107
IPR017441
437-463 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGAGGFGTVYKLAMDDGNVFALKRIVK

Gene3D: G3DSA:1.10.510.10
509-722 no description

GGSLDEVLHEKSEQLDWDARINIILGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGSFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQFGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGENREREIVDLNCEGVHTETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVITPCPSDFYDSEXPPGRTSH

PatternScan: PS00108
IPR008271
550-562 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox